(data stored in SCRATCH zone)

EMBL: AL009126.RAPJ

AL009126.RAPJ        Location/Qualifiers
FT   CDS_pept        304430..305551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapJ"
FT                   /locus_tag="BSU_02820"
FT                   /old_locus_tag="BSU02820"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16816200; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12076"
FT                   /db_xref="GOA:O34327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4GYO"
FT                   /db_xref="SubtiList:BG12663"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34327"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16816200"
FT                   /protein_id="CAB12076.1"
FT                   /translation="MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEE
FT                   NQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYF
FT                   RGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYAS
FT                   QALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAA
FT                   YYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEA
FT                   YDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDT
FT                   AERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ"
     atgagagcaa agattccatc agaagaagta gcagtaaagc tgaatgaatg gtacaagctc        60
     attcgcgcat ttgaagcaga tcaagcagaa gcgttaaagc aggagattga atatgattta       120
     gaagatatgg aagagaatca ggacttgctt ttatattttt ctttgatgga attccggcat       180
     cgaatcatgc ttgataagct gatgccggtg aaagacagcg ataccaagcc tccgttctct       240
     gatatgctga acgaaattga aagcaatcag caaaaactca cgggcttact ggaatactac       300
     ttttattatt tcagaggaat gtacgaattc aagcagaaaa atttcatatt agcgattgac       360
     cattataaac atgccgagga aaagctcgag tatgtcgagg atgagatcga aaaagctgag       420
     tttcttttta aagtcgcaga agtgtattat cacatcaaac aaacgtattt ttccatgaat       480
     tatgcgagcc aggcgcttga tatctatacg aaatatgaac tgtacggtcg ccgccgggtt       540
     cagtgtgaat ttatcatcgc cggaaatttg accgatgtgt atcatcatga aaaagcactg       600
     acccacttgt gcagcgcttt agaacatgcc aggcagcttg aagaagcgta catgatcgct       660
     gctgcctatt ataatgtcgg acactgtaag tacagtctgg gtgattacaa agaagcggag       720
     ggctatttca aaacagccgc cgccattttt gaggagcaca actttcagca agctgttcaa       780
     gctgtatttt cactgaccca tatctactgt aaagagggaa aatacgacaa ggcagtagag       840
     gcttatgacc gcgggataaa gagcgcggct gaatgggagg atgacatgta cttgacgaaa       900
     ttccgcctca ttcatgagct gtatcttgga agcggcgacc tgaacgtgct tacagaatgc       960
     tttgacctgc tggaatccag gcagcttctt gctgacgccg aagatctgct gcatgataca      1020
     gcggaacgtt tcaatcagtt ggaacattac gagtccgccg ctttctttta ccgcaggctg      1080
     atgaatatta aaaagaagct tgccgagcag cgttttcaat ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page