(data stored in SCRATCH zone)

EMBL: AL009126.RICT

AL009126.RICT        Location/Qualifiers
FT   CDS_pept        41657..42484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ricT"
FT                   /locus_tag="BSU_00320"
FT                   /old_locus_tag="BSU00320"
FT                   /product="subunit of a sporulation, competence and biofilm
FT                   formation regulatory complex of RNaseY (RicAFT complex /
FT                   FAD / two [4Fe-4S]2+)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12270811, 23490197, 26434553,
FT                   27501195, 28295778; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11808"
FT                   /db_xref="GOA:P37541"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="SubtiList:BG10096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37541"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12270811, 23490197, 26434553, 27501195, 28295778"
FT                   /protein_id="CAB11808.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFHIEHDSCVIVETVRGVEYGQVV
FT                   IANKQVDEHDVVLPLRKVIRVADDRDLLIVEENKQEALSAFDICQKKVIEHGLDMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GEMITTANGPAKVVGLNILERVLQVELINREKVIEYTWEELLEEGVVSAQTTD"
     ttgtacaatg taattggtgt ccgctttaag aaagcgggta aaatatatta ttttgatccg        60
     aatggatttc atatagaaca tgacagctgc gtaattgtag aaactgtcag aggcgttgag       120
     tacggccagg tcgtaattgc aaataaacag gtggatgagc atgatgtggt gcttcccctt       180
     cgaaaagtga tacgtgtggc agacgatcgc gatcttctca ttgtagaaga aaataaacag       240
     gaagcactat cagcatttga tatctgccaa aagaaagtga ttgagcatgg cttggatatg       300
     aagctggtcg atgttgaatt cacgtttgat cgcaataaag tcatttttta cttcactgct       360
     gacggccgag tcgactttag agagcttgta aaggatttgg cttctatctt taagacaaga       420
     attgagctgc gccaaatcgg agtgagggat gaggcaaaaa tgctcggagg aatcggtcct       480
     tgcggaagaa tgctttgctg ttcaacgttt cttggagatt ttgaacccgt ttccattaaa       540
     atggccaagg atcagaactt gtctttaaat cctacgaaga tttcgggtct ttgcggacga       600
     ttgatgtgct gtctaaaata tgagaacgat gagtatgaga cggcaaaaga acagcttccg       660
     gatataggag aaatgattac gacagcaaac ggtcccgcga aggtcgtcgg actaaatatt       720
     ctggaacggg tgcttcaggt ggaactgata aaccgtgaaa aagtgataga atatacttgg       780
     gaagagctct tggaagaggg cgtcgtatcc gcacaaacca cagattaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page