(data stored in SCRATCH zone)

EMBL: AL009126.RIDA

AL009126.RIDA        Location/Qualifiers
FT   CDS_pept        55295..55672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ridA"
FT                   /locus_tag="BSU_00480"
FT                   /old_locus_tag="BSU00480"
FT                   /product="aminoacrylate/iminopropionate
FT                   hydrolase/deaminase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.99.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2113912, 12515541, 14729707,
FT                   10557275, 10919400, 10368157, 20562306, 23815688; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11824"
FT                   /db_xref="GOA:P37552"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="PDB:1QD9"
FT                   /db_xref="SubtiList:BG10111"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37552"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11824.1"
FT                   /translation="MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGD
FT                   IKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
     atgacaaaag cagtccacac aaaacatgcc ccagcggcaa tcgggcctta ttcacaaggg        60
     attatcgtca acaatatgtt ttacagctca ggccaaatcc ctttgactcc ttcaggcgaa       120
     atggtgaatg gcgatattaa ggagcagact catcaagtat tcagcaattt aaaggcggtt       180
     ctggaagaag cgggtgcttc ttttgaaaca gttgtaaaag caactgtatt tatcgcggat       240
     atggaacagt ttgcggaagt aaacgaagtg tacggacaat attttgacac tcacaaaccg       300
     gcgagatctt gtgttgaagt cgcgagactc ccgaaggatg cgttagtcga gatcgaagtt       360
     attgcactgg tgaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page