(data stored in SCRATCH zone)

EMBL: AL009126.RLBA

AL009126.RLBA        Location/Qualifiers
FT   CDS_pept        3206..3421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlbA"
FT                   /locus_tag="BSU_00030"
FT                   /old_locus_tag="BSU00030"
FT                   /product="RNA binding protein involved in ribosome
FT                   maturation"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 24637032, 24939895; Product
FT                   type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11779"
FT                   /db_xref="GOA:P05650"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="SubtiList:BG10067"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05650"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:24637032, 24939895"
FT                   /protein_id="CAB11779.1"
FT                   /translation="MANPISIDTEMITLGQFLKLADVIQSGGMAKWFLSEHEVLVNDEP
FT                   DNRRGRKLYVGDVVEIEGFGSFQVVN"
     atggcaaatc cgatttcaat tgatacagag atgattacac tcggacaatt cttaaaatta        60
     gccgatgtga ttcagtctgg cggtatggcg aagtggtttt taagcgagca tgaagtgctt       120
     gtgaacgatg agccggacaa ccgccggggc agaaagctgt atgttggaga tgtggtagag       180
     attgaaggat ttggttcatt tcaagtcgtc aattaa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page