(data stored in ACNUC7421 zone)

EMBL: AL009126.RLMB

AL009126.RLMB        Location/Qualifiers
FT   CDS_pept        115269..116018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="BSU_00960"
FT                   /old_locus_tag="BSU00960"
FT                   /product="23S rRNA (Gm2251)-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.185"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11698387, 12377117, 16014871;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00960"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11872"
FT                   /db_xref="GOA:Q06753"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="SubtiList:BG10157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06753"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11872.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELA
FT                   KKQGITIQYVPRKKLDQMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDE
FT                   LEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTL
FT                   EEMKERGIWVVGTDASAREDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAG
FT                   KVTSLNASVAAGLLMYEVYRKRNPVGE"
     atgagtcagc aacatgatta cgtcataggg aaaaatgcag tgatcgagac gttaaaatct        60
     gatcggaagc tgtataagct gtggatggcg gaaaacaccg taaagggaca agcacagcaa       120
     gtgattgagc ttgccaaaaa gcagggaatc acgattcaat acgtcccgag aaaaaaactc       180
     gatcaaatgg tgacaggaca gcatcagggc gtagtggcac aggttgcagc gtatgaatat       240
     gcagaactgg acgatttata taaagcagcc gaagaaaaaa atgaacagcc tttcttcctc       300
     attctggacg agcttgaaga ccctcataat cttggttcca ttatgaggac agcagatgcg       360
     gtcggcgctc atggcatcgt cattccaaaa cggagagctg tcgggctgac aacaacagtg       420
     gcaaaagctt caacaggagc aattgagcac attcctgtag caagagtcac caatttggca       480
     cggacgttag aagagatgaa agagcgggga atctgggttg tcggaacgga tgcgtccgcg       540
     cgtgaggatt tccgtaatat ggacggcaat atgcctttgg ctctagtcat cggaagtgaa       600
     ggaaaaggga tgggccgcct tgtgaaggaa aagtgcgatt ttctcattaa actcccgatg       660
     gccggaaagg taacttcact aaatgcatct gtcgcggctg gtcttttgat gtatgaagtc       720
     taccggaaac gaaaccctgt gggagaataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page