(data stored in SCRATCH zone)

EMBL: AL009126.RLMG

AL009126.RLMG        Location/Qualifiers
FT   CDS_pept        121068..121673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmG"
FT                   /locus_tag="BSU_01060"
FT                   /old_locus_tag="BSU01060"
FT                   /product="23S rRNA m2G1835 methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.174"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17010380; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11882"
FT                   /db_xref="GOA:P37872"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10727"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37872"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11882.1"
FT                   /translation="MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFG
FT                   SRLLIDSFEEPEVEGGILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQ
FT                   NGITNVKIYQSDLFSNVDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIV
FT                   IQKKQGAPSAIEKLEELFDEVSVVQKKKGYYIIKAKKV"
     atgagtgagc actattattc agaaaaacct tcagtaaaaa gcaacaagca aacctggtct        60
     tttaggcttc ggaataaaga tttcacgttt accagcgaca gcggggtttt ttctaaaaaa       120
     gaagttgatt tcggctcccg cctgctgatt gattcttttg aagagcctga ggttgagggc       180
     ggcattttag atgtaggctg cggatacggc ccgattggtt tatcgctcgc cagcgacttt       240
     aaagaccgga ccatccacat gattgacgtt aatgagagag ccgtagaact atcaaatgaa       300
     aatgcggaac agaacggaat aacaaacgtt aagatttatc aaagcgattt gttttcaaac       360
     gttgattctg ctcaaacatt tgcttctatt cttacaaatc ccccaatccg agccggaaaa       420
     aaagttgtcc atgctatctt tgagaaaagc gctgaacact taaaagcttc aggtgaattg       480
     tggatcgtca tacagaaaaa gcaaggcgcg ccttctgcca ttgaaaagct cgaggaactg       540
     ttcgatgaag tttccgtcgt tcaaaaaaag aaaggctatt atatcataaa agcaaaaaaa       600
     gtttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page