(data stored in ACNUC7421 zone)

EMBL: AL009126.RNMV

AL009126.RNMV        Location/Qualifiers
FT   CDS_pept        50087..50647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="BSU_00410"
FT                   /old_locus_tag="BSU00410"
FT                   /product="ribonuclease M5"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.26.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11233981, 11976317, 12794188,
FT                   16077031; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11817"
FT                   /db_xref="GOA:P37547"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="SubtiList:BG10104"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37547"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11233981, 11976317, 12794188, 16077031"
FT                   /protein_id="CAB11817.1"
FT                   /translation="MKIKEIIVVEGRDDTARIKLAVDADTIETNGSAIDDHVIDQIRLA
FT                   QKTRGVIILTDPDFPGEKIRKTISEAVPGCKHAFLPKHLAKPKNKRGIGVEHASVESIR
FT                   ACLENVHEEMEAQPSDISAEDLIHAGLIGGPAAKCRRERLGDLLKIGYTNGKQLQKRLQ
FT                   MFQIKKSDFMSALDTVMREEQNE"
     atgaaaatta aagagatcat tgtggtcgag gggcgtgacg atacggcccg catcaaattg        60
     gctgttgatg cagacacaat tgaaacaaat ggttcagcca tcgatgatca tgtgattgac       120
     caaatccgtt tggcccagaa gacgagaggc gtcattattt taacggatcc ggactttccg       180
     ggagagaaga ttcgcaaaac catctcagag gctgtacccg gctgtaagca tgcatttttg       240
     ccaaaacatc ttgccaaacc taaaaacaag cggggaattg gtgtggagca tgcatcggtt       300
     gaaagcatta gggcatgttt agaaaatgtg catgaggaga tggaagcgca gccgagtgac       360
     atttcagctg aggatttgat tcatgccgga ctaataggcg ggcctgcggc caaatgccgc       420
     cgggaacgac tgggtgatct gttgaaaatc ggctatacaa atggcaaaca gcttcaaaaa       480
     cggctgcaaa tgtttcaaat taaaaaaagt gattttatga gtgcgctcga taccgttatg       540
     cgggaggaac agaatgaata a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page