(data stored in SCRATCH zone)

EMBL: AL009126.RPLA

AL009126.RPLA        Location/Qualifiers
FT   CDS_pept        119111..119809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BSU_01030"
FT                   /old_locus_tag="BSU01030"
FT                   /product="ribosomal protein L1 (BL1)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 16352840, 17981968,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11879"
FT                   /db_xref="GOA:Q06797"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06797"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11879.2"
FT                   /translation="MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKI
FT                   QQGWFDFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGV
FT                   KVDSSTFNVK"
     atggctaaaa aaggtaaaaa gtacgttgaa gctgctaagc ttgtagaccg ttctaaagct        60
     tacgacgtct ctgaagcagt agctctcgtt aaaaaaacaa acacagctaa attcgacgct       120
     acagttgaag tggctttccg tttaggggtt gaccctcgta aaaacgacca gcaaatccgt       180
     ggagcagttg tgcttccaaa cggaactggt aaaactcagc gcgttctcgt tttcgcaaaa       240
     ggcgaaaaag cgaaagaagc tgaagctgct ggtgcagatt tcgtaggcga tactgactac       300
     atcaacaaaa ttcaacaagg ctggttcgat ttcgatgtta tcgtagctac acctgacatg       360
     atgggtgaag ttggtaaaat cggtcgtgta cttggaccaa aaggtttaat gccgaaccct       420
     aaaactggta cagttacttt cgaagttgaa aaagctatcg gcgaaatcaa agctggtaaa       480
     gttgaatacc gcgttgataa agctggaaac attcatgttc ctatcggtaa agtttctttc       540
     gaggatgaaa aacttgttga gaacttcaca acaatgtacg atacaatcct taaagctaaa       600
     cctgctgcag ctaaaggcgt ttacgtgaaa aacgttgctg taacttctac tatgggacct       660
     ggtgtcaaag tagactcttc aacttttaac gtaaaataa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page