(data stored in SCRATCH zone)

EMBL: AL009126.RPLB

AL009126.RPLB        Location/Qualifiers
FT   CDS_pept        137311..138144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BSU_01190"
FT                   /old_locus_tag="BSU01190"
FT                   /product="ribosomal protein L2 (BL2)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 23249812, 24637032;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11895"
FT                   /db_xref="GOA:P42919"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42919"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 23249812, 24637032"
FT                   /protein_id="CAB11895.2"
FT                   /translation="MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNN
FT                   QGKLTVRHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKRYI
FT                   LAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHELINIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKKNKSDKFIVRRRKNK"
     atggcgatta aaaagtataa accgacctct aatggacgtc gtggcatgac aacttcagat        60
     tttgctgaaa tcacgactga caagccggaa aaatccttgc ttgctcccct tcacaaaaaa       120
     ggcggacgta acaaccaagg taaattgact gtacgtcacc aaggtggcgg acataaacgc       180
     caataccgtg ttatcgactt caaacgcgat aaagatggta tacctggacg cgttgctaca       240
     gttgaatacg atccaaaccg ttcagctaac atcgctctaa tcaactatgc agacggagaa       300
     aaacgttaca ttcttgctcc taaaggaatt caagtaggta ctgaaatcat gtcaggtcct       360
     gaagctgaca ttaaagtagg taatgcactt ccacttatca acatccctgt tggtacagtt       420
     gtgcataaca ttgaattaaa acctggtaaa ggcggacagc ttgtacgttc agctggtaca       480
     tctgctcagg ttcttggtaa agaaggtaaa tacgttcttg tacgtcttaa ctctggtgaa       540
     gttcgcatga tcctttctgc ttgccgtgct tctatcggtc aagtaggtaa cgaacagcac       600
     gaacttatca acattggtaa agctggacgt tctcgctgga aaggcatccg tcctacagtt       660
     cgtggttctg taatgaaccc taacgatcac ccacacggtg gtggtgaagg acgtgcgcca       720
     atcggacgta aatcaccaat gtctccatgg ggcaaaccaa ctcttggatt caagactcgt       780
     aagaaaaaga acaaatccga taaatttatc gtacgtcgtc gtaaaaataa ataa             834
//

If you have problems or comments...

PBIL Back to PBIL home page