(data stored in SCRATCH zone)

EMBL: AL009126.RPLC

AL009126.RPLC        Location/Qualifiers
FT   CDS_pept        135712..136341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BSU_01160"
FT                   /old_locus_tag="BSU01160"
FT                   /product="ribosomal protein L3 (BL3)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 19154332,
FT                   23759864; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11892"
FT                   /db_xref="GOA:P42920"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11218"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 19154332, 23759864"
FT                   /protein_id="CAB11892.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDG
FT                   YEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
FT                   GEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLITVKSAVKSK"
     atgaccaaag gaatcttagg aagaaaaatt ggtatgacgc aagtattcgc tgagaatggt        60
     gatcttattc cggtaactgt tatcgaggct gctccaaacg ttgttcttca aaagaaaaca       120
     gctgaaaacg acggttacga agcaatccag cttggttttg acgacaagcg tgaaaagctt       180
     tctaacaaac ctgaaaaagg gcacgttgca aaagcggaaa ctgctcctaa gcgcttcgtt       240
     aaagaattac gcggagtgga aatggatgcg tatgaagttg gtcaggaagt caaggttgaa       300
     attttctctg ctggagaaat cgtagatgta acaggagtat ctaaaggtaa aggtttccaa       360
     ggtgcgatca agcgccacgg acaatctcgc ggacctatgt ctcacggttc acgctaccac       420
     cgtcgtcctg gttcaatggg acctgtagat cctaaccgtg tattcaaagg taaattatta       480
     cctggacgta tgggcggaga gcaaatcact gttcaaaacc ttgaaatcgt aaaagttgat       540
     gcagaacgca atcttctttt gatcaaaggt aacgtacctg gtgcgaagaa atctttaatc       600
     actgttaaaa gtgctgttaa atctaaataa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page