(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLD

AL009126.RPLD        Location/Qualifiers
FT   CDS_pept        136369..136992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BSU_01170"
FT                   /old_locus_tag="BSU01170"
FT                   /product="ribosomal protein L4"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10898684, 12682299, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11893"
FT                   /db_xref="GOA:P42921"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11219"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42921"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11893.1"
FT                   /translation="MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKNRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEVLA"
     atgccaaaag tagcattata caaccaaaac ggttctactg ctggtgacat cgaattaaac        60
     gcttctgtat ttggtatcga accaaatgag agtgttgtat tcgacgctat tcttatgcaa       120
     agagcttcct tacgtcaagg aactcacaaa gtaaaaaatc gttctgaagt acgcggcgga       180
     ggtcgtaaac catggcgtca aaaaggtact ggacgtgccc gtcaaggttc aatccgttca       240
     ccgcaatggc gcggaggtgg tgtcgtattc ggcccaacac cacgcagcta ttcttataaa       300
     ttacctaaaa aagttcgccg cttggcaatc aaatcagtat tgtcttctaa agtgatcgac       360
     aacaacatca tcgttcttga agatcttact cttgatacgg ctaaaacaaa agaaatggca       420
     gctatcctta aaggattatc tgttgagaaa aaagctttaa tcgtaactgc ggatgcaaac       480
     gaagcagtag cattatctgc tcgtaacatt cctggagtta ctgttgttga agctaacgga       540
     atcaacgttt tagacgttgt caaccacgag aagcttctga ttacaaaagc agcggttgaa       600
     aaagtagagg aggtgcttgc ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page