(data stored in SCRATCH zone)

EMBL: AL009126.RPLE

AL009126.RPLE        Location/Qualifiers
FT   CDS_pept        141195..141734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BSU_01280"
FT                   /old_locus_tag="BSU01280"
FT                   /product="ribosomal protein L5 (BL6)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11904"
FT                   /db_xref="GOA:P12877"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12877"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11904.1"
FT                   /translation="MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDSAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
     atgaaccgcc ttaaagaaaa gtacaataaa gaaattgcac ctgctttaat gactaagttc        60
     aactatgatt cagtcatgca agtgcctaaa atcgaaaaaa tcgtaatcaa catgggtgtt       120
     ggtgacgctg ttcaaaacgc caaagcaatc gacagtgctg ttgaggaatt aacgtttatc       180
     gcaggtcaaa aacctgtcgt tactcgtgcg aagaaatcaa ttgctggatt ccgtcttcgt       240
     gagggaatgc ctatcggtgc gaaagtaact cttcgcggag agcgcatgta tgatttcctt       300
     gataaactta tttctgtatc tttaccgcgt gtacgtgact tccgcggggt ttctaaaaaa       360
     tctttcgacg gtcgcggtaa ctacacactt ggtatcaaag aacagttaat cttccctgaa       420
     attgactacg ataaagtaac aaaggttcgc ggaatggaca tcgttatcgt aacaactgct       480
     aatactgacg aagaagctcg tgagctatta actcaagtag gtatgccgtt ccagaaataa       540
//

If you have problems or comments...

PBIL Back to PBIL home page