(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLF

AL009126.RPLF        Location/Qualifiers
FT   CDS_pept        142402..142941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BSU_01310"
FT                   /old_locus_tag="BSU01310"
FT                   /product="ribosomal protein L6 (BL8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 25330043; Product type
FT                   s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11907"
FT                   /db_xref="GOA:P46898"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11408"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46898"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11907.1"
FT                   /translation="MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIK
FT                   VEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKL
FT                   VLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGI
FT                   RYEGEVVRRKEGKSAK"
     atgtctcgtg taggtaagaa gctacttgag attccttctg atgttacagt aacgttaaat        60
     gataacaaca ctgtagctgt gaaaggacca aaaggagaat taactcgtac gtttcaccct       120
     gatatggaga ttaaagtaga ggacaatgtg cttacagtcg ctcgtccttc tgatcaaaaa       180
     gagcaccgtg ccctgcatgg tacgactcgc agtctgcttg gcaacatggt tgaaggtgta       240
     tctaaaggat ttgaaagagg tttggaatta gtcggtgtcg gttaccgtgc ttctaaatcc       300
     ggaaataaac ttgttttaaa cgttggatac tctcatcctg ttgagatcgt tcctgaagaa       360
     ggcatcgaaa tcgaagttcc ttctcaaaca aaagtagttg taaaaggtac agacaaagaa       420
     cgcgtaggag ctattgctgc taacatccgc gctgtacgtt ctccagagcc ttacaaaggt       480
     aaaggaatcc gctacgaagg tgaagttgtt cgccgtaaag aaggtaaatc tgctaagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page