(data stored in SCRATCH zone)

EMBL: AL009126.RPLK

AL009126.RPLK        Location/Qualifiers
FT   CDS_pept        118591..119016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BSU_01020"
FT                   /old_locus_tag="BSU01020"
FT                   /product="ribosomal protein L11 (BL11)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11244072, 19653700, 20441189;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01020"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11878"
FT                   /db_xref="GOA:Q06796"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="SubtiList:BG10163"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06796"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11244072, 19653700, 20441189"
FT                   /protein_id="CAB11878.2"
FT                   /translation="MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TADQAGLIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDK
FT                   VREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED"
     gtggctaaaa aagtagttaa agttgtaaaa ttgcaaattc ctgctggaaa agctaaccca        60
     gcaccaccag ttggacctgc acttggtcaa gccggtgtta acatcatggg attctgtaag       120
     gagtttaacg ctcgtacagc tgaccaagct ggtttaatca ttcctgttga aatttcggtt       180
     tacgaagacc gttcatttac atttattaca aaaactccac ctgctgcagt attgcttaaa       240
     aaagcagctg gaattgagtc tggttctggt gaaccaaacc gtaataaagt ggcaaccgtt       300
     aagcgcgata aagtacgcga aatcgctgaa acgaaaatgc ctgacttaaa cgcagcagac       360
     gttgaagcgg caatgcgcat ggttgaaggt actgcccgca gtatgggtat tgtaatcgag       420
     gattaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page