(data stored in SCRATCH zone)

EMBL: AL009126.RPLL

AL009126.RPLL        Location/Qualifiers
FT   CDS_pept        120607..120978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BSU_01050"
FT                   /old_locus_tag="BSU01050"
FT                   /product="ribosomal protein L12 (BL9)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 6771249, 8755892,
FT                   26101249; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11881"
FT                   /db_xref="GOA:P02394"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="SubtiList:BG10726"
FT                   /db_xref="UniProtKB/Swiss-Prot:P02394"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 6771249, 8755892, 26101249"
FT                   /protein_id="CAB11881.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGA
FT                   AAGGAAEEQSEFDLILAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKE
FT                   EAEELKAKLEEVGASVEVK"
     atggctttaa atatcgaaga aatcattgct tccgttaaag aagcaactgt acttgaattg        60
     aacgacctag taaaagcaat cgaagaagaa tttggcgtaa ctgctgctgc tcctgtagct       120
     gtagctggcg gagctgctgc tggcggagct gctgaagagc aaagcgaatt cgatcttatc       180
     cttgctggtg caggatctca aaaaatcaaa gttatcaaag ttgtacgtga aatcactggt       240
     cttggcttga aagaagctaa agagcttgtt gacaacactc caaaaccact taaagaaggt       300
     attgctaaag aagaagctga agagcttaaa gctaaacttg aagaagttgg cgcttctgta       360
     gaagttaagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page