(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLM

AL009126.RPLM        Location/Qualifiers
FT   CDS_pept        153842..154279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BSU_01490"
FT                   /old_locus_tag="BSU01490"
FT                   /product="ribosomal protein L13"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10781545, 12682299, 23504016,
FT                   22720735; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11925"
FT                   /db_xref="GOA:P70974"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11970"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70974"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10781545, 12682299, 23504016, 22720735"
FT                   /protein_id="CAB11925.2"
FT                   /translation="MRTTPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG"
     atgcgtacaa cacctatggc taacgcaagt actattgaac gcaagtggtt agttgttgat        60
     gctgctggca agactttagg tcgtctttct tcagaagttg cagctatcct tcgcggaaaa       120
     cacaaaccaa cttacacacc acacgttgat actggagatc atgtgatcat catcaacgct       180
     gaaaaaatcg agttaactgg taaaaagtta actgacaaaa tctactaccg tcacactcaa       240
     catccaggcg gattaaaatc aagaactgct cttgaaatgc gtacaaacta ccctgagaaa       300
     atgcttgagc ttgctatcaa aggcatgctt ccaaaaggtt ctctaggtcg tcaaatgttc       360
     aaaaaattga acgtataccg tggttctgag catccacacg aagcacaaaa acctgaagtt       420
     tacgaacttc gcggttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page