(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLNA

AL009126.RPLNA       Location/Qualifiers
FT   CDS_pept        140451..140819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplNA"
FT                   /locus_tag="BSU_01260"
FT                   /old_locus_tag="BSU01260"
FT                   /product="ribosomal protein L14"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 8805509, 12682299,
FT                   22829778; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11902"
FT                   /db_xref="GOA:P12875"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10758"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12875"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 8805509, 12682299, 22829778"
FT                   /protein_id="CAB11902.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRENNFMKIVSLAPEVI"
     atgattcaac aagagactcg tttaaaagta gctgacaact ctggcgcacg tgaagtactt        60
     actattaaag ttcttggtgg ttctggacgt aaaacagcta acattggtga tgtaattgtt       120
     tgcacggtta aacaagcaac accaggaggc gttgtcaaaa aaggtgaagt cgtaaaagct       180
     gttatcgttc gcactaaaag cggagcgcgc agaagtgacg gttcatacat cagcttcgat       240
     gagaatgcat gtgttatcat ccgtgacgac aagagcccac gcggaactcg tatcttcgga       300
     ccagttgctc gtgaattgcg tgaaaacaac tttatgaaaa ttgtttctct agctccagaa       360
     gttatctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page