(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLO

AL009126.RPLO        Location/Qualifiers
FT   CDS_pept        144085..144525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BSU_01350"
FT                   /old_locus_tag="BSU01350"
FT                   /product="ribosomal protein L15"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15855514, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11911"
FT                   /db_xref="GOA:P19946"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10444"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15855514, 23002217"
FT                   /protein_id="CAB11911.1"
FT                   /translation="MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISK
FT                   LNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI"
     atgaaacttc atgaattaaa accttcagaa ggttcacgca aaacgcgtaa tcgcgtaggt        60
     cgtggtattg gttctggcaa cggtaaaaca gctggtaaag gtcacaaagg tcaaaacgct       120
     cgttctggcg gcggtgtacg ccctggattc gaggggggac aaatgccttt attccaacgt       180
     cttcctaaac gtggtttcac taacatcaac cgcaaggaat acgctgtagt caacctagac       240
     aaattgaacg gttttgcaga aggaacggaa gtcactcctg aacttcttct agagactggt       300
     gttattagca aacttaatgc aggagtaaag attcttggca acggtaaatt agagaaaaaa       360
     ttaactgtaa aagccaataa attctctgct tctgcgaaag aagctgttga agctgctggc       420
     ggtacagctg aggtgatcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page