(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLQ

AL009126.RPLQ        Location/Qualifiers
FT   CDS_pept        149953..150315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BSU_01440"
FT                   /old_locus_tag="BSU01440"
FT                   /product="ribosomal protein L17 (BL15)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6801428, 10717392, 12682299;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11920"
FT                   /db_xref="GOA:P20277"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11041"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20277"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6801428, 10717392, 12682299"
FT                   /protein_id="CAB11920.1"
FT                   /translation="MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKL
FT                   GPRRGDGAPMAIIELV"
     atgtcataca gaaaactagg acgtacgagt gcacagcgta aagctatgct tcgtgatctt        60
     acaactgatt tgatcatcaa cgaaagaatc gaaacaactg aaacacgtgc gaaagaactt       120
     cgctctgtag ttgaaaaaat gatcacgctt ggcaaacgcg gtgatcttca cgctcgccgt       180
     caagctgctg catacatccg caacgaggtt gcaaacgaag aaaataatca agatgcactt       240
     caaaaattat tctctgacat tgcaactcgt tacgaggagc gccaaggtgg atacacacgt       300
     attatgaagc ttggtcctcg ccgtggtgac ggagcaccaa tggcaattat cgaattggtt       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page