(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLR

AL009126.RPLR        Location/Qualifiers
FT   CDS_pept        142974..143336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BSU_01320"
FT                   /old_locus_tag="BSU01320"
FT                   /product="ribosomal protein L18"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11908"
FT                   /db_xref="GOA:P46899"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11409"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46899"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11908.2"
FT                   /translation="MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQII
FT                   DDVNGVTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHG
FT                   RVKALADAAREAGLKF"
     atgattacga aaactagcaa aaatgctgct cgtcttaaaa gacacgctcg tgttcgcgct        60
     aaactttccg gtactgctga aagaccgcgc ctgaacgttt tccgttctaa caagcacatt       120
     tacgctcaaa tcatcgatga tgtaaatggt gtaacacttg ctagtgcatc tactctcgat       180
     aaagacttga acgttgaaag cactggagat acttctgctg ctactaaagt tggagaatta       240
     gttgcaaaac gcgctgctga aaaaggcatt tctgacgtag tatttgaccg tggcggatac       300
     ttataccatg gacgtgtaaa agctttggct gatgccgctc gtgaagctgg acttaaattt       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page