(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLV

AL009126.RPLV        Location/Qualifiers
FT   CDS_pept        138497..138838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BSU_01210"
FT                   /old_locus_tag="BSU01210"
FT                   /product="ribosomal protein L22 (BL17)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7928988, 12682299, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11897"
FT                   /db_xref="GOA:P42060"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42060"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7928988, 12682299, 23002217"
FT                   /protein_id="CAB11897.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASP
FT                   IIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   IVVSEKKEG"
     atgcaagcta aagctgttgc aagaacagtc cgtattgctc ctcgtaaagc acgtctagta        60
     atggacctga ttcgaggcaa gcaagtaggt gaggcagtat caatcttgaa ccttacacca       120
     agagctgctt ctccaattat cgagaaagta ttaaaatccg ctattgcaaa tgctgagcat       180
     aactatgaaa tggacgctaa caacctggtt atttctcaag cattcgttga cgaaggccct       240
     acgttaaaaa gattccgccc acgtgctatg ggacgtgcga gccaaatcaa caaacgtacg       300
     agccacatta caatcgttgt atcagaaaag aaggagggat aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page