(data stored in ACNUC7421 zone)

EMBL: AL009126.RPLW

AL009126.RPLW        Location/Qualifiers
FT   CDS_pept        136992..137279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BSU_01180"
FT                   /old_locus_tag="BSU01180"
FT                   /product="ribosomal protein L23"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17981968, 23002217;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11894"
FT                   /db_xref="GOA:P42924"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42924"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17981968, 23002217"
FT                   /protein_id="CAB11894.2"
FT                   /translation="MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVES
FT                   IFGVKVDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
     atgaaagatc ctcgtgatgt tctaaagcgc cccgtcatta ctgaacgttc tgccgattta        60
     atgactgaaa aaaaatatac ttttgaagtt gatgtaagag ctaacaaaac agaagtgaaa       120
     gacgcggttg aaagcatctt tggagtgaaa gttgacaaag tcaacatcat gaactacaaa       180
     ggcaaatcaa aacgtgttgg acgctacact ggtatgacta gccgtcgcag aaaagcgatc       240
     gtaaaactta ctgcagacag caaagaaatc gaaatttttg aagcttaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page