(data stored in SCRATCH zone)

EMBL: AL009126.RPLX

AL009126.RPLX        Location/Qualifiers
FT   CDS_pept        140857..141168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BSU_01270"
FT                   /old_locus_tag="BSU01270"
FT                   /product="ribosomal protein L24 (BL23)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11278078, 12682299; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11903"
FT                   /db_xref="GOA:P0CI78"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10759"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI78"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11278078, 12682299"
FT                   /protein_id="CAB11903.1"
FT                   /translation="MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHS
FT                   KPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
     atgcatgtaa aaaaaggcga taaagttatg gttatctctg gtaaagataa aggcaaacaa        60
     ggaacaatcc ttgctgcttt ccctaaaaag gaccgcgttt tagttgaagg tgttaacatg       120
     gtaaagaaac actctaaacc aactcaagct aaccctcaag gcggtatttc taatcaagag       180
     gcgccaattc atgtatcaaa cgttatgccg ctcgatccta aaacaggtga agtgactcgc       240
     gtaggataca aagtggaaga tggcaaaaaa gttcgtgtag caaaaaaatc tgggcaagtt       300
     ctagataaat ag                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page