(data stored in SCRATCH zone)

EMBL: AL009126.RPMC

AL009126.RPMC        Location/Qualifiers
FT   CDS_pept        139924..140124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BSU_01240"
FT                   /old_locus_tag="BSU01240"
FT                   /product="ribosomal protein L29"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 23002217; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11900"
FT                   /db_xref="GOA:P12873"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="PDB:3J3V"
FT                   /db_xref="PDB:3J3W"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12873"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 23002217"
FT                   /protein_id="CAB11900.1"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKAIARMKTVIREREIAANK"
     atgaaagcta atgaaattcg tgaccttacc actgctgaaa ttgaacaaaa agtaaagtct        60
     cttaaagaag aacttttcaa tcttcgcttt caattagcga caggacaact tgaaaatact       120
     gctcgcattc gtgaagtgcg caaagctatc gcgcgcatga aaactgtgat tcgtgaaaga       180
     gaaattgctg ctaataaata a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page