(data stored in SCRATCH zone)

EMBL: AL009126.RPMJ

AL009126.RPMJ        Location/Qualifiers
FT   CDS_pept        147837..147950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BSU_01400"
FT                   /old_locus_tag="BSU01400"
FT                   /product="ribosomal protein L36 (ribosomal protein B)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1783905, 23002217, 24335279;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11916"
FT                   /db_xref="GOA:P20278"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG11042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20278"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1783905, 23002217, 24335279"
FT                   /protein_id="CAB11916.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
     atgaaagtga gaccatcagt taaaccaatc tgcgaaaaat gtaaagttat tcgcagaaaa        60
     ggaaaagtaa tggtgatctg tgaaaatcca aagcataaac aaaaacaagg ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page