(data stored in SCRATCH zone)

EMBL: AL009126.RPOA

AL009126.RPOA        Location/Qualifiers
FT   CDS_pept        148931..149875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BSU_01430"
FT                   /old_locus_tag="BSU01430"
FT                   /product="RNA polymerase (alpha subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1484484, 6811591, 9594570,
FT                   10972808, 12682299, 22720735; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11919"
FT                   /db_xref="GOA:P20429"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="PDB:1Z3E"
FT                   /db_xref="PDB:3GFK"
FT                   /db_xref="PDB:3IHQ"
FT                   /db_xref="SubtiList:BG10732"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20429"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1484484, 6811591, 9594570, 10972808, 12682299,
FT                   22720735"
FT                   /protein_id="CAB11919.1"
FT                   /translation="MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGE
FT                   GTVTAADITHDSDVEILNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVSYQVENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
     atgatcgaga ttgaaaaacc aaaaatcgaa acggttgaaa tcagcgacga tgccaaattt        60
     ggtaagtttg tcgtagagcc acttgagcgt ggatatggta caactctggg taactcctta       120
     cgtcgtatcc tcttatcctc actccctggt gccgctgtaa catcaatcca gatagatggt       180
     gtactgcacg aattctcgac aattgaaggc gttgtggaag atgttacaac gattatctta       240
     cacattaaaa agcttgcatt gaaaatctac tctgatgaag agaagacgct agaaattgat       300
     gtacagggtg aaggaactgt aacggcagct gatattacac acgatagtga tgtagagatc       360
     ttaaatcctg atcttcatat cgcgactctt ggtgagaatg cgagtttccg agttcgcctt       420
     actgctcaaa gaggacgtgg gtatacgcct gctgacgcaa acaagagaga cgatcagcca       480
     atcggcgtga ttccgatcga ttctatctat acgccagttt ctcgtgtatc ttatcaggta       540
     gagaacactc gtgtaggcca agttgcaaac tatgataaac ttacacttga tgtttggact       600
     gatggaagca ctggaccgaa agaagcaatt gcgcttggtt caaagatttt aactgaacac       660
     cttaatatat tcgttggttt aactgacgaa gctcaacatg ctgaaatcat ggttgaaaaa       720
     gaagaagatc aaaaagagaa agttcttgaa atgacaattg aagaattgga tctttctgtt       780
     cgttcttaca actgcttaaa gcgtgcgggt attaacacgg ttcaagagct tgcgaacaag       840
     acggaagaag atatgatgaa agttcgaaat ctaggacgca aatcacttga agaagtgaaa       900
     gcgaaactag aagaacttgg actcggactt cgcaaagacg attga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page