(data stored in SCRATCH zone)

EMBL: AL009126.RPOB

AL009126.RPOB        Location/Qualifiers
FT   CDS_pept        121919..125500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BSU_01070"
FT                   /old_locus_tag="BSU01070"
FT                   /product="RNA polymerase (beta subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10049799, 10744988, 12455702,
FT                   12682299, 15060052, 28163698; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11883"
FT                   /db_xref="GOA:P37870"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="PDB:2LY7"
FT                   /db_xref="SubtiList:BG10728"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37870"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10049799, 10744988, 12455702, 12682299, 15060052,
FT                   28163698"
FT                   /protein_id="CAB11883.2"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYPVEESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEILDLIGENEYLRNTLD
FT                   KDNTENSDKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAEKGQILDRRTLDKVLPYLENGIGFRKLYPNGGVVED
FT                   EVTLQSIKIFAPTDQEGEQVINVIGNAYIEEEIKNITPADIISSISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSYAKVNRFGFIETPYRRVDPETGKVTGRIDYLTADEEDNYVVAQ
FT                   ANARLDDEGAFIDDSIVARFRGENTVVSRNRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPEAPFVGTGMEYVSGKDSGAAVICKHPGIVERVEAKNVWVRR
FT                   YEEVDGQKVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMELGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDDRGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDEEDAKQA
FT                   DGLALSGDEEPEETASADVERDVVTKE"
     ttgacaggtc aactagttca gtatggacga caccgccagc gcagaagcta tgctcgcatt        60
     agcgaagtgt tagaattacc aaatctcatt gaaattcaaa cctcttctta tcagtggttt       120
     cttgatgagg gtcttagaga gatgtttcaa gacatatcac caattgagga tttcactggt       180
     aacctctctc ttgagttcat tgattatagt ttaggtgagc ctaaatatcc tgtagaggaa       240
     tcaaaagaac gtgatgtgac ttactcagct ccgctaagag tgaaggttcg tttaattaac       300
     aaagaaactg gagaggtaaa agaccaagat gtcttcatgg gtgatttccc tattatgaca       360
     gatacaggta cttttatcat taacggtgcg gaacgtgtta tcgtttccca gcttgttcgg       420
     tctccaagtg tatatttcag tggtaaagta gacaaaaacg gtaaaaaagg ttttaccgca       480
     actgtcattc caaaccgtgg cgcatggtta gaatacgaaa ctgatgcgaa agatgttgtt       540
     tatgtccgca ttgatcgcac acgtaagttg ccggttacgg ttcttttgcg tgctctcggc       600
     ttcggctccg atcaagagat tcttgatctc ataggagaaa acgaatacct gcgaaatacg       660
     cttgataaag ataacacaga aaacagcgac aaagcgttgc tggaaattta cgagcgtctc       720
     cgtcctggag agccgcctac agtagaaaat gcgaaaagct tgcttgattc tcgtttcttt       780
     gatccgaaac gatacgatct tgccaatgta ggacgctata aaattaataa aaaacttcat       840
     attaagaatc gcctcttcaa tcagagactt gctgaaacgc ttgttgatcc tgaaacagga       900
     gaaatccttg ctgaaaaagg ccagattctt gatagaagaa cgcttgataa agtactgcca       960
     tacttagaaa acggaatcgg ttttagaaag ctgtatccga atggcggcgt tgttgaagat      1020
     gaagtgactc ttcaatcaat taaaatcttt gctccgactg atcaagaagg agaacaggtt      1080
     atcaatgtaa tcggcaatgc ttacatcgaa gaagagatta aaaacatcac gcctgctgat      1140
     attatttctt caatcagcta cttcttcaac ctgctgcacg gagtaggcga cacagatgat      1200
     atcgatcatc ttggaaaccg ccgtttacgt tctgtaggcg agcttctcca gaaccaattc      1260
     cgtatcggtt taagccgtat ggagcgtgtg gttcgtgaga gaatgtcaat tcaagatacg      1320
     aatacaatta cgcctcagca gctgatcaat attcgtcctg ttattgcgtc cattaaagag      1380
     ttctttggaa gctcacagct ttctcaattc atggatcaga cgaacccgct tgctgaatta      1440
     acgcacaagc gtcgtctgtc agcattagga ccgggcggat tgacacgtga gcgtgccgga      1500
     atggaagtgc gtgacgttca ctactcccac tatggccgta tgtgtccgat tgaaacgcct      1560
     gagggcccga acatcggttt gatcaactca ctatcatctt atgcaaaagt aaaccgtttt      1620
     ggctttattg aaacgccata tcgccgcgtt gaccctgaaa cagggaaggt aacgggcaga      1680
     atcgattact taactgctga tgaagaggat aactatgttg tcgctcaagc gaatgctcgt      1740
     cttgatgacg aaggcgcctt tattgatgac agcatcgtag ctcgtttccg cggggagaac      1800
     accgttgttt ccagaaatcg tgtagactac atggatgtat cgcctaagca ggttgtatct      1860
     gctgcgacag catgtatccc gttcttagaa aacgatgact ccaaccgtgc cctcatggga      1920
     gcgaacatgc agcgtcaggc tgtgcctttg atgcagccgg aagcgccatt tgttggaact      1980
     ggtatggaat acgtatcagg aaaagactct ggtgccgctg ttatttgtaa acaccctggt      2040
     atcgttgaac gcgtagaagc caaaaacgtt tgggttcgcc gttatgaaga agtagacggt      2100
     caaaaagtaa aaggaaacct ggataaatac agcctgctga aatttgtccg ctctaaccaa      2160
     ggtacgtgct acaaccagcg tccgatcgta agtgtcggcg atgaagtggt aaaaggagaa      2220
     atccttgctg acggtccttc tatggagctt ggtgaacttg cacttggccg taacgtaatg      2280
     gtcggcttca tgacgtggga tggctacaac tatgaggatg ccatcatcat gagtgaacgc      2340
     ctagtgaagg atgatgttta tacatctatc cacattgaag aatacgaatc agaagcacgt      2400
     gatacgaaac ttggacctga agaaatcact cgcgatattc caaacgtcgg tgaagatgcg      2460
     cttcgcaatc ttgatgaccg cggaatcatc cgtattgggg cagaagtaaa agacggagat      2520
     cttcttgttg gtaaagtaac gcctaaaggc gtaactgaac tgactgccga agaacgcctt      2580
     cttcacgcca tctttggcga gaaagcccgc gaggttcgtg atacttctct tcgtgtgcct      2640
     catggcggcg gcggaattat ccatgacgtt aaagtcttca accgtgaaga cggagacgaa      2700
     cttcctccag gtgttaacca gttagtacgc gtatatatcg ttcagaaacg taagatttct      2760
     gaaggggata aaatggccgg tcgtcacggt aacaaaggtg ttatctctaa gattcttcct      2820
     gaagaggata tgccttacct tcctgacggc acaccaattg atatcatgct taacccgctg      2880
     ggcgtaccat cacgtatgaa catcgggcag gtattggaac ttcacatggg tatggccgct      2940
     cgttaccttg gcattcacat tgcatctcct gtatttgacg gagcgcgaga agaggatgtc      3000
     tgggaaacac ttgaagaagc cggcatgtct cgtgacgcca aaacagtgct ttacgacgga      3060
     cgtactggag agccgtttga taaccgtgta tctgtcggta tcatgtacat gatcaaactg      3120
     gctcacatgg ttgacgataa acttcatgca cgctctacag gcccttactc acttgttacg      3180
     cagcagcctc ttggcggtaa agcgcaattt ggcggacagc gttttggtga gatggaggtt      3240
     tgggcacttg aagcttacgg tgcggcttac actcttcaag aaattctgac tgttaagtct      3300
     gatgacgtgg ttggacgtgt gaaaacatac gaagccatcg ttaaaggcga caatgttcct      3360
     gaaccaggtg ttccggaatc attcaaagta ttaatcaaag aacttcaaag cttaggtatg      3420
     gatgtcaaaa tcctttctgg tgatgaagaa gaaatagaaa tgagagattt agaagacgaa      3480
     gaagatgcga aacaagctga cggcctggca ttatcaggtg atgaagagcc ggaagaaaca      3540
     gcatctgcag acgttgaacg cgatgtagta acaaaagaat aa                         3582
//

If you have problems or comments...

PBIL Back to PBIL home page