(data stored in SCRATCH zone)

EMBL: AL009126.RPOC

AL009126.RPOC        Location/Qualifiers
FT   CDS_pept        125562..129161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BSU_01080"
FT                   /old_locus_tag="BSU01080"
FT                   /product="RNA polymerase (beta' subunit)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10672039, 10675340, 10910724,
FT                   11029421, 9795209, 10438769, 23070162, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11884"
FT                   /db_xref="GOA:P37871"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="SubtiList:BG10729"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37871"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10672039, 10675340, 10910724, 11029421, 9795209,
FT                   10438769, 23070162, 22720735"
FT                   /protein_id="CAB11884.2"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPANTPLEKKQLLSEKEYRAYLDKYG
FT                   NKFQASMGAEAIHKLLQDIDLVKEVDMLKEELKTSQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFK
FT                   NTDEALLAYQNGYVHLHTRVAVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQEILEEAQSKVDNVMKQFRRGLITE
FT                   EERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKPLKEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDED
FT                   KALEIVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQ
FT                   EIVVQGAVETRSYTAPYNSRLKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVL
FT                   LEGNRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMMKYRKVKPVSNVQPTDDMVPVE"
     ttgctagatg tgaacaattt tgagtatatg aacatcggtc ttgcttcacc agataaaatc        60
     cgttcatggt cttttggtga agtgaaaaag cctgaaacga taaactatcg tacgttaaaa       120
     cctgaaaagg acggtctatt ctgcgaacgc attttcggac cgactaagga ctgggaatgt       180
     cattgcggga agtacaagcg agttcgttat aaaggcgtag tttgtgaccg ctgcggagtc       240
     gaagtaacac gggctaaagt ccgtcgtgag agaatggggc acattgaact ggctgcccca       300
     gtttcccaca tttggtattt caaaggtatt ccaagccgta tgggtcttgt gctggatatg       360
     tcacctcgtg ctttagaaga agtcatttac tttgcttctt acgttgtaac tgatccggcg       420
     aatacaccgc ttgaaaagaa acagcttctg tctgagaaag aataccgtgc ttatcttgat       480
     aaatacggta ataaattcca agcatctatg ggtgctgaag caattcataa acttcttcaa       540
     gatatcgatc ttgtaaaaga agttgatatg ttaaaagaag agctgaaaac ttcacaagga       600
     caacgccgta ctcgtgcgat caaacgtctt gaagttttag aagccttccg taactcagga       660
     aacaagcctt cttggatgat ccttgatgtg cttcctgtta ttcctccgga gcttagaccg       720
     atggttcagc tagatggcgg acgttttgcg acttctgatt tgaatgacct ttatcgtcgt       780
     gtcatcaacc gtaacaatcg tttgaaacgc cttttggacc ttggtgcgcc tagcatcatc       840
     gttcaaaacg aaaagcgtat gcttcaagag gctgtcgatg ccctaattga caacggccgc       900
     cgcggacgcc ctgtaacagg tcctggaaac agaccgttaa aatctctttc tcacatgctg       960
     aaagggaagc aaggccgttt ccgtcaaaac cttcttggta aacgtgtcga ttactccgga      1020
     cgttctgtaa tcgttgttgg tcctcatttg aaaatgtacc aatgcggatt accgaaggaa      1080
     atggcacttg aacttttcaa acctttcgtt atgaaagaac ttgttgaaaa aggtcttgct      1140
     cacaacatta agagtgcgaa acgcaaaatt gagcgcgtac agcctgaagt ttgggatgta      1200
     ctagaatcag ttattaagga gcatccggta ctgctgaacc gtgcccctac acttcacaga      1260
     ttaggtatcc aggcgtttga accaacgctt gttgaaggac gcgcaatccg tcttcacccg      1320
     ctcgtatgta cagcttacaa cgctgacttt gacggtgacc aaatggcggt tcacgtacca      1380
     ttatctgctg aagcacaagc tgaagcacgc atcttgatgc ttgctgctca aaacatcttg      1440
     aaccctaaag atggtaaacc ggttgtaaca ccgtctcagg atatggtact aggtaactat      1500
     tacctgacac ttgagcgtgc cggtgctgtc ggtgaaggta tggtcttcaa gaatacagac      1560
     gaagcgcttc ttgcttatca aaacggatat gttcaccttc atacgagagt agctgttgca      1620
     gctaactcac ttaagaatgt gacatttacc gaagaacagc gctcaaaatt gttaattaca      1680
     actgtcggta agcttgtctt caatgaaatt cttccggaat cattccctta catgaatgaa      1740
     ccaacgaaga gcaacattga agagaaaaca cctgaccgtt tcttcttaga aaaaggtgct      1800
     gatgttaaag ctgttatcgc acagcagcca atcaatgcgc cgtttaaaaa aggcattctg      1860
     ggtaaaatca tcgcggaaat ctttaaacga ttccatatta cggaaacgtc taaaatgctt      1920
     gaccgcatga aaaacctagg tttcaaatat tcaactaaag ctggtattac agttggggtt      1980
     tctgacatcg tcgtactcga tgataaacaa gaaattcttg aggaagcgca aagcaaagtt      2040
     gacaacgtta tgaagcaatt ccgccgcggt cttatcactg aagaagaacg ctatgagaga      2100
     gtcatctcta tctggagtgc tgcaaaagac gttatccaag gcaaactgat gaaatcactt      2160
     gatgaactca acccgatcta catgatgagt gactctggtg cccgtggtaa cgcatctaac      2220
     tttacgcagc ttgccggaat gcgcggcctg atggccaacc cggctggacg tatcattgag      2280
     ttgccgatca aatcaagttt ccgtgaaggt ctgacagtat tggagtactt tatctccaca      2340
     cacggtgcgc gtaaaggtct tgccgatacc gctcttaaaa ctgctgactc aggttacctt      2400
     acacgccgtc tcgttgacgt tgctcaggat gttatcatcc gtgaaactga ttgcggaact      2460
     gaccgaggca ttcttgctaa gcctcttaaa gaaggaactg aaacaattga gcgcttagaa      2520
     gaacgcttaa tcggacgttt tgcaagaaaa caagtgaagc accctgaaac aggtgaagtg      2580
     cttgtgaatg aaaacgaact gatcgatgaa gataaagcac tggagattgt cgaagccggc      2640
     attgaagaag tgtggatccg ttctgccttc acatgtaata cgcctcatgg tgtatgtaaa      2700
     cgatgctatg gccgaaatct tgcaactggc tccgatgttg aagtcggtga agctgtcgga      2760
     atcattgctg cccaatcaat cggtgagcct ggtacacagt taacaatgcg tacattccat      2820
     acaggcgggg ttgccggaga cgatatcaca cagggtcttc cgcgtatcca agagcttttc      2880
     gaagcgcgta atccgaaagg tcaggcaaca attacagaaa tcgacggtac agtcgttgag      2940
     atcaatgaag ttcgtgataa gcaacaggaa attgtggttc aaggcgcagt ggaaacacgt      3000
     tcttatacgg caccttacaa ctcccgcctg aaagtagcgg aaggagataa aattactcga      3060
     ggccaagtac tgacagaagg ttcaatcgat ccgaaagaac ttcttaaagt gactgacctg      3120
     acgactgttc aagagtatct tctccatgag gttcaaaagg tttaccgtat gcagggtgtt      3180
     gaaatcggtg ataaacacgt agaagtaatg gttcgccaga tgcttcgcaa agtacgcgtg      3240
     attgatgccg gtgacactga tgtgcttcca ggtacattgc ttgatattca ccaatttact      3300
     gaagcgaaca aaaaggtatt gcttgaaggc aaccgaccag ctacaggccg tcctgtctta      3360
     ctcggtatta caaaagcatc tcttgaaact gattcattct tatctgctgc ttccttccag      3420
     gaaacaacac gtgtccttac agatgcagcg atcaaaggta agcgtgacga gcttctcggc      3480
     ttgaaagaga atgttatcat cggtaagctt gttccagcag gtacaggaat gatgaaatac      3540
     cgtaaagtaa aaccagtatc aaatgttcag ccgactgacg atatggtccc ggttgaataa      3600
//

If you have problems or comments...

PBIL Back to PBIL home page