(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSC

AL009126.RPSC        Location/Qualifiers
FT   CDS_pept        138842..139498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BSU_01220"
FT                   /old_locus_tag="BSU01220"
FT                   /product="ribosomal protein S3 (BS3)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299; Product type s:
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11898"
FT                   /db_xref="GOA:P21465"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19005"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21465"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299"
FT                   /protein_id="CAB11898.2"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTKKKNEEGGK"
     gtgggtcaaa aggtaaatcc agtcggtctt cgtatcggag tcattcgtga ttgggaatct        60
     aagtggtacg ctggtaaaga ttacgctgac ttcctgcacg aagatttaaa aattcgtgaa       120
     tacattagca aacgcctttc tgacgcttct gtttctaaag tagaaattga gcgtgcagca       180
     aaccgcgtta acattacgat ccacacagct aagcctggta tggttatcgg taaaggcggt       240
     tctgaagtcg aagcacttcg caaagccctt aacagcctta ctggcaagcg tgtacacatt       300
     aacattcttg aaatcaaaag agcagatctt gatgcacagc tagttgctga caacatcgct       360
     cgtcaattag aaaaccgtgt ttctttccgc cgtgcgcaga aacaacaaat ccaacgtact       420
     atgcgtgctg gagcacaagg tgtgaaaaca atggtttctg gtcgtcttgg cggtgcagat       480
     atcgctcgtt ctgaatacta cagtgaagga actgttccat tgcacacatt acgtgcggac       540
     attgactatg caacatctga agctgatact acttacggta agcttggtgt aaaagtctgg       600
     atctatcgtg gagaggttct tcctactaag aagaaaaatg aggaaggagg aaaataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page