(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSE

AL009126.RPSE        Location/Qualifiers
FT   CDS_pept        143361..143861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BSU_01330"
FT                   /old_locus_tag="BSU01330"
FT                   /product="ribosomal protein S5"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6211592, 12682299; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11909"
FT                   /db_xref="GOA:P21467"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21467"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6211592, 12682299"
FT                   /protein_id="CAB11909.1"
FT                   /translation="MRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNILLKPASEGTG
FT                   VIAGGPVRAVLELAGVADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
     atgcgtcgta ttgacccaag caaattagag ttagaagaac gcttagttac ggttaaccgc        60
     gtagcgaaag ttgttaaagg tggtcgtcgt ttccgcttcg cagctctagt cgttgtcggt       120
     gacaaaaacg gacacgtagg attcggtact ggtaaagcac aagaagtacc agaagcgatt       180
     cgcaaagctg ttgaagatgc gaaaaagaat ttgattgaag taccaatggt tggaactaca       240
     attccacacg aaatcatcgg acgtttcggt gcaggtaaca tcttgttaaa acctgcttct       300
     gaaggtactg gagttatcgc tggaggccct gtacgtgcgg tacttgagct agctggtgta       360
     gctgatatcc tttctaagtc tttaggttct aacacaccga tcaacatgat tcgtgcaaca       420
     cttcaaggtt taagtgaact taaacgtgct gaagacgttg cgaagcttcg tggaaaatct       480
     gtagaagaac tgttaggata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page