(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSG

AL009126.RPSG        Location/Qualifiers
FT   CDS_pept        130160..130630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BSU_01110"
FT                   /old_locus_tag="BSU01110"
FT                   /product="ribosomal protein S7 (BS7)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8722036, 12682299, 19653700;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11887"
FT                   /db_xref="GOA:P21469"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21469"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8722036, 12682299, 19653700"
FT                   /protein_id="CAB11887.2"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKSQTILYK
FT                   SFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
     atgccacgta aaggtcctgt agcaaaaaga gatgttttac ctgatccgat ttacaactct        60
     aagcttgtat ctcgtttaat caacaaaatg atgatcgatg gtaaaaaagg taagtctcaa       120
     acgatcctat acaagtcatt cgatatcatt aaagaacgta ctggcaatga tgcaatggag       180
     gttttcgaac aagcattgaa aaacatcatg cctgtacttg aagtaaaagc acgccgtgta       240
     ggtggtgcga actaccaagt tcctgtagaa gttcgtcctg aacgtcgtac gactcttgga       300
     cttcgctggt tagttaacta cgctcgtctt cgtggagaaa aaacgatgga agagcgttta       360
     gctaacgaaa tccttgacgc agctaacaac actggtgctg ctgttaagaa acgtgaagac       420
     actcataaga tggctgaagc aaacaaagca tttgctcact atcgctggta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page