(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSH

AL009126.RPSH        Location/Qualifiers
FT   CDS_pept        141974..142372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BSU_01300"
FT                   /old_locus_tag="BSU01300"
FT                   /product="ribosomal protein S8 (BS8)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11906"
FT                   /db_xref="GOA:P12879"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10762"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12879"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11906.2"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEIPASKLKREIAEILKREGF
FT                   IRDVEFVEDSKQGIIRVFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLTDKEARAKQAGGEVLAYVW"
     atggttatga cagatccaat tgcagatatg ctaactcgta ttcgcaatgc aaacatggta        60
     cgtcatgaga agcttgaaat tcctgcttct aaattgaaaa gagaaattgc tgaaatttta       120
     aagcgtgaag gtttcattcg tgacgttgag ttcgtagaag acagcaaaca aggtattatc       180
     cgcgttttct tgaaatacgg acaaaacaac gagcgcgtta tcactggtct taaaagaatc       240
     agcaagcctg gtttgcgtgt ttatgctaaa tctaatgaag taccccgcgt acttaacggt       300
     cttggaatcg cgattatttc tacatcacaa ggtgttttaa cggacaaaga agcccgtgca       360
     aaacaagctg gtggagaagt tctagcatac gtttggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page