(data stored in SCRATCH zone)

EMBL: AL009126.RPSI

AL009126.RPSI        Location/Qualifiers
FT   CDS_pept        154300..154692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BSU_01500"
FT                   /old_locus_tag="BSU01500"
FT                   /product="ribosomal protein S9"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 19653700, 22720735;
FT                   Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11926"
FT                   /db_xref="GOA:P21470"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19007"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21470"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11926.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALI
FT                   EDIKQPLTLTETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
     ttggcacagg ttcaatatta cggtactggc cgtcgtaaaa gctctgtagc gcgtgtgcgt        60
     ttagttccag gagaaggccg tatcgtcgtt aataatcgtg aaatcagcga acatatccca       120
     tctgcagctt taatcgaaga tatcaaacaa ccattaactt tgactgaaac agctggcact       180
     tatgatgttt tagtaaacgt acatggaggc ggcctatctg gtcaagctgg agcaatccgt       240
     cacggtatcg ctcgtgcttt gcttgaagca gatccagaat accgtacaac tcttaaacgt       300
     gcaggtcttc tgactcgtga cgctcgtatg aaagaacgta aaaaatacgg tcttaaaggc       360
     gctcgtcgtg cacctcagtt ctcaaaacgt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page