(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSJ

AL009126.RPSJ        Location/Qualifiers
FT   CDS_pept        135364..135672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BSU_01150"
FT                   /old_locus_tag="BSU01150"
FT                   /product="ribosomal protein S10 (BS13); transcription
FT                   antitermination factor"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 27964882; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11891"
FT                   /db_xref="GOA:P21471"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21471"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 27964882"
FT                   /protein_id="CAB11891.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
     atggcaaaac aaaaaattcg tattcgtttg aaagcatatg atcatagaat ccttgatcaa        60
     tctgcagaga agattgttga aacggcaaaa cgttctggtg ccagcgtatc tggtccgatt       120
     ccgttgccaa ctgaaaaatc agtttacaca atccttcgtg cggtgcacaa atacaaagat       180
     tctcgtgagc aatttgaaat gcgtacacat aaacgtttaa tcgacattgt gaacccaaca       240
     ccacaaactg ttgatgctct tatgcgatta gacttaccat ctggtgtcga tatcgaaatt       300
     aaactttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page