(data stored in ACNUC7421 zone)

EMBL: AL009126.RPSL

AL009126.RPSL        Location/Qualifiers
FT   CDS_pept        129702..130118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BSU_01100"
FT                   /old_locus_tag="BSU01100"
FT                   /product="ribosomal protein S12 (BS12)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11489846, 12682299, 16484214,
FT                   18252828, 19383706, 20007320; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11886"
FT                   /db_xref="GOA:P21472"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG19009"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21472"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11489846, 12682299, 16484214, 18252828, 19383706,
FT                   20007320"
FT                   /protein_id="CAB11886.2"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVENRAQGRSKYGTKKPKAK"
     atgcctacaa ttaatcagct aattcgcaaa ggacgcgtga gtaaagtaga aaactcaaag        60
     tctcctgcac ttaacaaagg atacaacagc tttaaaaaag agcacactaa cgtatcttct       120
     ccacaaaaac gcggggtatg tactcgtgtt ggtacaatga caccgaaaaa accgaactca       180
     gcacttcgta aatatgctcg tgttcgtttg actaacggaa tcgaggttac tgcttacatt       240
     cctggtatcg gtcacaacct gcaagagcac agtgttgtac ttatccgcgg cggacgtgta       300
     aaagacttac caggggtacg ttaccacatc gttcgtggtg cgcttgatac tgctggagtt       360
     gaaaaccgtg cacaaggccg ttctaaatac ggtacgaaaa aacctaaagc aaaataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page