(data stored in SCRATCH zone)

EMBL: AL009126.RPSNA

AL009126.RPSNA       Location/Qualifiers
FT   CDS_pept        141757..141942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsNA"
FT                   /locus_tag="BSU_01290"
FT                   /old_locus_tag="BSU01290"
FT                   /product="ribosomal protein S14"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 17163968, 19648245,
FT                   20208344, 27561249; Product type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11905"
FT                   /db_xref="GOA:P12878"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10761"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12878"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 17163968, 19648245, 20208344, 27561249"
FT                   /protein_id="CAB11905.1"
FT                   /translation="MAKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
     gtggctaaaa agtctatgat tgcgaaacaa caacgtacac caaagtttaa agtacaagag        60
     tacacacgct gtgaacgctg cggacgtccg cattcagtca ttcgtaaatt taaactttgc       120
     cgtatttgtt tccgtgagct tgcatataaa ggacaaattc ctggcgtgaa aaaagccagc       180
     tggtaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page