(data stored in SCRATCH zone)

EMBL: AL009126.RPSQ

AL009126.RPSQ        Location/Qualifiers
FT   CDS_pept        140147..140410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BSU_01250"
FT                   /old_locus_tag="BSU01250"
FT                   /product="ribosomal protein S17 (BS16)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299; Product type s:
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11901"
FT                   /db_xref="GOA:P12874"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="PDB:3J9W"
FT                   /db_xref="PDB:5NJT"
FT                   /db_xref="PDB:6HA1"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="SubtiList:BG10757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12874"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299"
FT                   /protein_id="CAB11901.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKK
FT                   FKAHDENNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVII"
     atgagcgaac gtaaccaacg caaagtttac caaggccgtg ttgtttctga caaaatggat        60
     aaaaccatta ctgttgttgt tgagacatac aaaaaacata cactttacgg taaacgcgta       120
     aaatactcaa aaaaattcaa agcacatgat gaaaataatc aagctaaaat cggtgacatc       180
     gttaagatca tggaaactcg tccattgtct gcaactaagc gtttccgtct agttgaagtt       240
     gtcgaagaag ctgttattat ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page