(data stored in SCRATCH zone)

EMBL: AL009126.RSMA

AL009126.RSMA        Location/Qualifiers
FT   CDS_pept        50640..51518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmA"
FT                   /locus_tag="BSU_00420"
FT                   /old_locus_tag="BSU00420"
FT                   /product="dimethyladenosine 16S ribosomal RNA transferase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 99430, 6801425, 11327780,
FT                   1690648, 22391551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11818"
FT                   /db_xref="GOA:P37468"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:6IFS"
FT                   /db_xref="PDB:6IFT"
FT                   /db_xref="PDB:6IFV"
FT                   /db_xref="PDB:6IFW"
FT                   /db_xref="SubtiList:BG10105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37468"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11818.1"
FT                   /translation="MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILNRIVDHAE
FT                   VTEKTGVIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILKDTLSPYENVTVIHQDVL
FT                   KADVKSVIEEQFQDCDEIMVVANLPYYVTTPIIMKLLEEHLPLKGIVVMLQKEVAERMA
FT                   ADPSSKEYGSLSIAVQFYTEAKTVMIVPKTVFVPQPNVDSAVIRLILRDGPAVDVENES
FT                   FFFQLIKASFAQRRKTLLNNLVNNLPEGKAQKSTIEQVLEETNIDGKRRGESLSIEEFA
FT                   ALSNGLYKALF"
     atgaataaag atattgcgac accgattaga acgaaagaga tactgaagaa atacggtttt        60
     tcttttaaaa agagcttagg acagaatttc ttaattgata cgaacatttt aaacagaatt       120
     gttgatcacg cggaagtgac ggagaaaaca ggtgtcattg aaatcggccc gggaatcggg       180
     gctttaaccg aacagcttgc caagcgggcg aaaaaggtcg tggcatttga gattgaccag       240
     cgattattgc cgattctgaa ggatacactg tcaccttacg aaaatgtcac tgtcattcat       300
     caggacgtgt taaaggctga tgtcaaatca gtcattgaag aacaatttca agattgtgat       360
     gagatcatgg tagttgccaa ccttccttat tacgtaacaa caccgattat catgaaactg       420
     cttgaagaac atcttccgct gaaagggatt gtggttatgc tgcaaaaaga agtggctgag       480
     cgcatggcgg ctgatccttc atctaaggaa tacggctcgc tttcaatcgc ggtgcagttt       540
     tatacagaag ccaaaacggt gatgatcgtc ccgaaaaccg tatttgttcc tcagcctaat       600
     gtcgattccg cagtcattcg tctgattctc cgagacggcc cggcagtgga cgtggaaaac       660
     gaatcctttt tctttcagct catcaaggca agctttgcac agcgccgtaa aacgctgctc       720
     aataacttag ttaacaatct gcctgaagga aaagcacaaa aatcaacgat tgaacaagtg       780
     ctcgaagaaa caaatattga cggtaagcgc cgaggtgaat ccctgtctat tgaggaattc       840
     gcagcgctgt ctaacggatt gtataaagcc cttttctaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page