(data stored in ACNUC7421 zone)

EMBL: AL009126.RSMI

AL009126.RSMI        Location/Qualifiers
FT   CDS_pept        43921..44799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmI"
FT                   /locus_tag="BSU_00360"
FT                   /old_locus_tag="BSU00360"
FT                   /product="16S rRNA 2'-O-ribose C1402 methyltransferase"
FT                   /function="16.8: Protect"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.198"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16014871, 19965768, 25893373;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11812"
FT                   /db_xref="GOA:P37544"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37544"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11812.1"
FT                   /translation="MLRRQMSFNGKSDMGILYLVPTPIGNLEDMTFRAIDTLKSVDAIA
FT                   AEDTRQTKKLCHVYEIETPLVSYHEHNKESSGHKIIEWLKSGKNIALVSDAGLPTISDP
FT                   GAEIVKDFTDIGGYVVPLPGANAALTALIASGIVPQPFFFYGFLNRQKKEKKKELEALK
FT                   KRQETIIFYEAPHRLKETLSAMAEILGDREIAVTRELTKKYEEFIRGTISEVIGWANED
FT                   QIRGEFCLVVEGSNNEEVDEEEQWWETLTAKEHVEHYISKGATSKEAIKKAAVDRNVPK
FT                   REVYDAYHIKQ"
     atgttaaggc gccaaatgag ctttaatgga aagtcggaca tggggattct ttacttggtc        60
     ccaaccccaa tcggaaattt agaggatatg acattccggg cgatcgacac gctgaaatca       120
     gtggatgcga ttgctgcgga agatacgagg caaacgaaaa agctttgtca tgtatatgaa       180
     attgaaacac cgctcgtcag ctatcacgaa cacaataaag aaagcagtgg gcacaaaatt       240
     attgaatggc tgaaatcggg aaaaaacatt gctcttgtca gtgatgccgg tctgccgacg       300
     atttctgatc ccggagcgga aattgtaaag gattttacgg atataggcgg ttatgttgtt       360
     ccgttgccgg gagcaaatgc tgcattaaca gctcttattg cttcaggtat tgtaccgcag       420
     ccttttttct tttacggttt tctcaacaga cagaaaaaag aaaagaagaa ggagcttgaa       480
     gcccttaaaa aacggcagga aacgatcatt ttttatgaag cgccccacag attgaaggaa       540
     accttgtcag cgatggcaga gatattagga gatcgggaaa ttgctgtaac acgtgaactc       600
     actaagaaat atgaagagtt tatccgagga accatatctg aggtcattgg atgggcaaac       660
     gaggatcaga tacgcggcga gttttgtctt gtcgtagaag gaagtaataa tgaagaggta       720
     gatgaggaag aacaatggtg ggaaaccctc actgcgaaag aacatgtcga gcattacatt       780
     tcgaaaggcg ctacgtctaa agaagctatt aaaaaagcag cagtcgatcg caatgtacca       840
     aagcgtgaag tgtacgatgc ttaccatatt aagcaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page