(data stored in ACNUC7421 zone)

EMBL: AL009126.RULS

AL009126.RULS        Location/Qualifiers
FT   CDS_pept        129340..129588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rulS"
FT                   /locus_tag="BSU_01090"
FT                   /old_locus_tag="BSU01090"
FT                   /product="K-turn RNA binding protein; alternative ribosomal
FT                   protein L7A"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.8: Protect"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11574053, 11948165, 17468242,
FT                   7657605, 22355167, 23249744, 24204571, 22720735; Product
FT                   type s: structure"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11885"
FT                   /db_xref="GOA:P46350"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="PDB:3V7E"
FT                   /db_xref="PDB:4LCK"
FT                   /db_xref="PDB:4TZP"
FT                   /db_xref="PDB:4TZV"
FT                   /db_xref="PDB:4TZW"
FT                   /db_xref="PDB:4TZZ"
FT                   /db_xref="SubtiList:BG11365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46350"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11574053, 11948165, 17468242, 7657605, 22355167,
FT                   23249744, 24204571, 22720735"
FT                   /protein_id="CAB11885.1"
FT                   /translation="MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSV
FT                   VSLAEDQGISVSMVESMKKLGKACGIEVGAAAVAIIL"
     atgtcttatg ataaagtatc acaggccaaa tcaattatta ttggtacgaa gcaaacagtg        60
     aaagctctaa agcgaggttc agtaaaggaa gtagtcgttg caaaagacgc agatccgata       120
     ctcacgtcaa gtgttgtttc acttgctgaa gatcaaggta tctctgtctc aatggttgaa       180
     tccatgaaaa agctcggcaa agcctgcgga attgaggtag gagcagccgc tgttgccatt       240
     attttataa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page