(data stored in ACNUC7421 zone)

EMBL: AL009126.SALA

AL009126.SALA        Location/Qualifiers
FT   CDS_pept        157421..158479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="salA"
FT                   /locus_tag="BSU_01540"
FT                   /old_locus_tag="BSU01540"
FT                   /product="phosphorylation-dependent (Y327) transcriptional
FT                   regulator"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11790741, 15126467, 26094643;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11930"
FT                   /db_xref="GOA:P50863"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="SubtiList:BG11494"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50863"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11790741, 15126467, 26094643"
FT                   /protein_id="CAB11930.1"
FT                   /translation="MIREDEVRKLVGEMREPFLQRPLGELDAVKEIKIKPEKRHISVKV
FT                   ALAKTGTAEQMQIQQEIVNVLKGAGAETVGLRFEELPEETVAKFRAPSAEKKTLLNMDN
FT                   PPVFLAVASGKGGVGKSTVSVNLAISLARLGKKVGLIDADIYGFSVPDMMGITVRPTIE
FT                   GEKLLPVERFGVKVMSMGFFVEENAPVVWRGPMLGKMLNNFFHEVEWGEVDYIVLDLPP
FT                   GTGDVALDVHTMLPSCKEIIVSTPHPTAAFVAARAGSMAIKTDHEVVGVIENMAYYESA
FT                   KTGEREYVFGKGGGDKLAEELNVPLLGRIPLKQPDWDKDQFAPSVYDENHPIGEIYQDI
FT                   AKKIDAKMSVQV"
     atgataagag aagatgaagt aagaaaacta gtcggagaaa tgcgcgaacc ttttcttcaa        60
     agacctctgg gagaattgga tgccgttaag gaaattaaaa taaagcctga aaaacggcat       120
     atcagtgtaa aagtcgctct tgcaaaaaca ggaactgcag aacaaatgca gattcagcaa       180
     gagatcgtaa acgtattaaa aggggcagga gctgagacag tcggccttcg atttgaagag       240
     ctgcctgaag aaacggttgc taaattccgg gcgccgtcag ctgagaaaaa aacattatta       300
     aatatggata acccgccagt ctttcttgct gtagcaagtg gaaaaggcgg cgtaggcaag       360
     tcaactgtgt cagtaaacct agctatttct ctggctcgtc tagggaaaaa ggttggttta       420
     attgatgcgg atatttatgg gttcagtgtg ccggacatga tgggtatcac tgtgcgtcca       480
     acaattgaag gagagaaact tcttcctgtt gaacgctttg gagtaaaggt catgtcaatg       540
     ggctttttcg tagaagaaaa tgccccggtc gtatggagag ggccgatgct cggcaaaatg       600
     ctgaataatt ttttccatga agtagagtgg ggagaagtag actatatcgt tcttgatctt       660
     ccgcctggta caggggacgt tgctctcgat gtacatacaa tgcttccgag ctgcaaagaa       720
     attatcgtat ctacgccaca tccgacagct gcttttgtcg cggccagagc gggctctatg       780
     gcgattaaaa ccgatcatga ggtcgtgggt gtcatagaga acatggctta ttatgaaagt       840
     gcaaagacag gggaaagaga atatgtgttt ggaaaaggcg gaggagataa actggctgag       900
     gaactaaacg tgcctttgct cggcagaatc ccattgaaac agcccgattg ggataaggac       960
     caatttgctc cgtctgttta tgacgaaaat catccaatcg gagaaatata tcaggacatc      1020
     gcaaaaaaaa tagatgcaaa aatgtcagtg caggtataa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page