(data stored in ACNUC7421 zone)

EMBL: AL009126.SECE

AL009126.SECE        Location/Qualifiers
FT   CDS_pept        117532..117711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BSU_01000"
FT                   /old_locus_tag="BSU01000"
FT                   /product="preprotein translocase subunit"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11976315, 12682299, 16242710,
FT                   22304380, 22720735; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01000"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11876"
FT                   /db_xref="GOA:Q06799"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="SubtiList:BG10161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06799"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11976315, 12682299, 16242710, 22304380, 22720735"
FT                   /protein_id="CAB11876.1"
FT                   /translation="MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFAL
FT                   LDTGISQLIRLIVE"
     atgcgtatta tgaaattctt taaagatgtt gggaaagaaa tgaaaaaggt aagctggcct        60
     aaaggaaaag agttaacgcg ttataccatt acggtaattt caacagttat cttttttgtt       120
     atcttttttg ccctccttga cacaggaatt tctcaattaa ttcgtttaat agttgaataa       180
//

If you have problems or comments...

PBIL Back to PBIL home page