(data stored in SCRATCH zone)

EMBL: AL009126.SECY

AL009126.SECY        Location/Qualifiers
FT   CDS_pept        144527..145822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BSU_01360"
FT                   /old_locus_tag="BSU01360"
FT                   /product="preprotein translocase subunit"
FT                   /function="16.1: Circulate"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9917412, 15341641, 15849754,
FT                   16850406, 23852076, 22720735, 27336478; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11912"
FT                   /db_xref="GOA:P16336"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="SubtiList:BG10445"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16336"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9917412, 15341641, 15849754, 16850406, 23852076,
FT                   22720735, 27336478"
FT                   /protein_id="CAB11912.1"
FT                   /translation="MFKTISNFMRVSDIRNKIIFTLLMLIVFRIGAFIPVPYVNAEALQ
FT                   AQSQMGVFDLLNTFGGGALYQFSIFAMGITPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNLANGMLIEKSGVSTYLIIALVLTGGTAFL
FT                   MWLGEQITSHGVGNGISIIIFAGIVSSIPKTIGQIYETQFVGSNDQLFIHIVKVALLVI
FT                   AILAVIVGVIFIQQAVRKIAIQYAKGTGRSPAGGGQSTHLPLKVNPAGVIPVIFAVAFL
FT                   ITPRTIASFFGTNDVTKWIQNNFDNTHPVGMAIYVALIIAFTYFYAFVQVNPEQMADNL
FT                   KKQGGYIPGVRPGKMTQDRITSILYRLTFVGSIFLAVISILPIFFIQFAGLPQSAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMKN"
     ttgtttaaaa caatctccaa ctttatgcgt gtgagtgata tcaggaataa aatcatattc        60
     actttactca tgcttatcgt ctttcgcata ggtgcgttta ttcctgtgcc ttacgttaac       120
     gctgaagcgt tacaggcaca gtctcaaatg ggtgtttttg atctccttaa tacatttggc       180
     ggcggtgcgc tttaccaatt ttccattttc gcaatgggaa ttactcctta tatcacggct       240
     tcgatcatca ttcagctgct tcagatggat gtggtaccga agtttaccga gtggtctaag       300
     caaggtgaag ttggccgccg taaattagct cagttcacaa ggtactttac gattgtgctt       360
     ggtttcatcc aagcgttagg tatgtcatat ggattcaaca atctggcaaa cggtatgctg       420
     atcgaaaaat ccggtgtatc gacatatctt atcattgctt tagtgctcac tggcggaact       480
     gcctttttaa tgtggcttgg ggaacaaatt acttctcatg gagtaggcaa cggaatatcg       540
     atcattatct tcgcggggat tgtgtctagt attccaaaaa caattgggca aatatatgag       600
     actcaatttg tcggcagcaa cgatcagttg tttattcata ttgtgaaagt cgcacttctt       660
     gtgattgcga ttttagcagt tattgttgga gttattttca ttcagcaagc cgtacggaaa       720
     attgcgattc aatatgctaa aggcacaggt cgttcacctg ctggcggagg tcagtctaca       780
     caccttccat tgaaagtgaa tcctgcaggg gttattccgg taatctttgc ggttgcgttt       840
     ttgataacgc cgcggacgat cgcgtcattc tttggaacaa acgatgtgac aaagtggatt       900
     caaaacaact ttgataatac gcatccggtg ggtatggcga tatatgttgc gttgattatt       960
     gcctttacgt acttttatgc ttttgtacag gtaaaccctg aacaaatggc tgataacctt      1020
     aaaaaacagg gtggctatat cccgggggtt cgtccaggga aaatgactca agatagaatt      1080
     acgagcattt tgtatcgact tacgtttgtg ggttctatat tcttagccgt gatttccatt      1140
     cttcctatct ttttcattca attcgctgga ttgcctcaaa gtgcacaaat tggcggaaca      1200
     tctttgttaa ttgttgtcgg ggtagccttg gagacaatga aacaactaga aagccagttg      1260
     gtgaaacgaa actaccgtgg atttatgaaa aactag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page