(data stored in SCRATCH zone)

EMBL: AL009126.SKFE

AL009126.SKFE        Location/Qualifiers
FT   CDS_pept        216913..217632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skfE"
FT                   /locus_tag="BSU_01950"
FT                   /old_locus_tag="BSU01950"
FT                   /product="sporulation killing factor biosynthesis and
FT                   export; ABC transporter (binding protein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 26284661; Product type t:
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11989"
FT                   /db_xref="GOA:O31427"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12718"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:26284661"
FT                   /protein_id="CAB11989.1"
FT                   /translation="MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTT
FT                   IRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHP
FT                   GKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGL
FT                   DIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQ
FT                   AEWRKEVIRLLGEWSDE"
     atgcaattga tgcaagtaca aaatttaagc aaatgctatc gaaatggtga tggggttgaa        60
     catttgtctt tctcaattca acgaggagaa atcgtggcgc tattggggcc aaatggagct       120
     ggaaaaacaa cgacaattcg atgtttgaca ggtctctata agccggataa aggagatatc       180
     ctcattgagg gttctcctcc aggagatata aatgttcaaa aaaaagtcgc gcttattcct       240
     gatcagccat atttgtatcc cgctttaact gctgctgaac atattcagtt tagggcaaga       300
     ggatatcatc caggtaaaaa agatgtaaaa gaaagggttt atcatgcatt gaaggaagtg       360
     cacttggagg agaaagcaaa ccaattgtgt ggtcagctgt caagaggcca aaagcagcgg       420
     gttgtcctgg cgggggcgat tgttcaagac gctttgctgt atatattaga cgaaccgact       480
     gtgggccttg atatcccatc aaaacagtgg ctctctaact ggttaaaaac taaaaccgat       540
     caagggtgtt cagcatttgt atcaactcat agtctagagt ttgttataga gacagcagac       600
     agggtgatat taattagaga cggcaaactc atgcaggatt tgtatgttcc tcaattcgaa       660
     gaacaagcgg aatggagaaa agaagtgatt cgtcttctag gggaatggtc agatgaataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page