(data stored in ACNUC7421 zone)

EMBL: AL009126.SLEL

AL009126.SLEL        Location/Qualifiers
FT   CDS_pept        complement(23868..25151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sleL"
FT                   /locus_tag="BSU_00160"
FT                   /old_locus_tag="BSU00160"
FT                   /product="spore peptidoglycan N-acetylglucosaminidase"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11011148, 11737650, 12177332,
FT                   10419957, 18456807, 18835992, 19933362, 28333204; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11792"
FT                   /db_xref="GOA:P37531"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="SubtiList:BG10080"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37531"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11792.1"
FT                   /translation="MVKQGDTLSAIASQYRTTTNDITETNEIPNPDSLVVGQTIVIPIA
FT                   GQFYDVKRGDTLTSIARQFNTTAAELARVNRIQLNTVLQIGFRLYIPPAPKRDIESNAY
FT                   LEPRGNQVSENLQQAAREASPYLTYLGAFSFQAQRNGTLVAPPLTNLRSITESQNTTLM
FT                   MIITNLENQAFSDELGRILLNDETVKRRLLNEIVENARRYGFRDIHFDFEYLRPQDREA
FT                   YNQFLREARDLFHREGLEISTALAPKTSATQQGRWYEAHDYRAHGEIVDFVVLMTYEWG
FT                   YSGGPPQAVSPIGPVRDVIEYALTEMPANKIVMGQNLYGYDWTLPYTAGGTPARAVSPQ
FT                   QAIVIADQNNASIQYDQTAQAPFFRYTDAENRRHEVWFEDARSIQAKFNLIKELNLRGI
FT                   SYWKLGLSFPQNWLLLSDQFNVVKKTFR"
     gtggtaaaac aaggcgacac tctttctgct atcgcttcac aatacagaac aaccacaaat        60
     gacatcactg aaacgaatga aataccgaat cccgacagcc ttgttgtcgg acaaaccatt       120
     gtcattccaa tagctggcca gttctatgat gtgaagcgag gtgataccct gacatccatc       180
     gcccggcagt tcaatacaac agcagccgag ctcgcaaggg ttaaccgcat ccagttaaat       240
     accgtgcttc agattggttt ccgtttatac atccctccag ctcctaaacg agacatcgaa       300
     tcaaatgctt atttggagcc ccgaggaaat caagtcagcg aaaatctcca gcaggcggcc       360
     agagaagcgt cgccctactt aacttacctt ggcgcattca gcttccaggc acagcggaac       420
     ggaaccttag tcgcaccgcc tttaacgaat ttaaggagca ttacagaaag tcaaaataca       480
     acattgatga tgattataac gaacctagaa aaccaggcat tcagcgatga acttggccgg       540
     atccttttga acgacgaaac tgtaaaaaga cggcttctaa atgaaatagt cgagaatgcc       600
     agaagatatg gcttccgtga cattcatttc gactttgaat atttgcggcc ccaggataga       660
     gaggcctata atcaattcct ccgcgaagca agggatcttt tccatcgaga gggcttagaa       720
     atttctacgg ctcttgctcc taaaacaagt gcaacacagc agggcaggtg gtatgaagct       780
     catgattaca gggcacatgg cgaaattgtc gactttgttg ttctcatgac atatgaatgg       840
     ggctatagcg gcggaccgcc tcaagcggtt tctccaattg gacctgtccg tgatgtcata       900
     gaatatgctt tgactgaaat gcctgcgaac aaaattgtca tgggccagaa tttatatgga       960
     tatgactgga cgctgccata tacagcaggg ggaactccag caagagcagt aagccctcag      1020
     caagccattg tcatagctga tcagaacaat gcttccattc agtatgacca aaccgctcaa      1080
     gctcctttct tccgctatac tgatgcagaa aacagaaggc acgaggtatg gttcgaggat      1140
     gcccgctcga ttcaagcaaa attcaatctg attaaagagc tgaatttaag aggcatcagc      1200
     tattggaagc tgggtctttc ctttccacaa aactggctgc tgctgtctga tcaatttaat      1260
     gttgtcaaaa agacgtttcg ataa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page