(data stored in ACNUC7421 zone)

EMBL: AL009126.SPCP

AL009126.SPCP        Location/Qualifiers
FT   CDS_pept        68216..68518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spcP"
FT                   /locus_tag="BSU_00600"
FT                   /old_locus_tag="BSU00600"
FT                   /product="spore protein involved in the shaping of the
FT                   spore coat"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10869437, 11283287, 15231775,
FT                   21904870, 22720735; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11836"
FT                   /db_xref="GOA:P37558"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="SubtiList:BG10123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37558"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10869437, 11283287, 15231775, 21904870, 22720735"
FT                   /protein_id="CAB11836.1"
FT                   /translation="MNSYYDQKGSSSVPEQHDVTMKGRKHLDISGVKHVESFDNEEFLL
FT                   ETVMGMLSVRGQNLQMKNLDVEKGIVSIKGRVFDLVYLDEQQGDKAKGFFSKLFK"
     atgaattcat attatgatca aaaaggttct tcgtctgttc cggaacagca tgatgtgaca        60
     atgaaaggcc ggaagcattt agatatttct ggggttaagc atgtggagag ttttgataac       120
     gaagaattcc tgctggaaac ggtgatggga atgctctccg tcagaggcca aaacctgcag       180
     atgaaaaatc ttgatgtgga aaaagggatt gtttcgatta aaggcagggt atttgattta       240
     gtgtacttag acgaacaaca aggggataaa gctaaagggt tttttagcaa gttgtttaaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page