(data stored in ACNUC7421 zone)

EMBL: AL009126.SPCQ

AL009126.SPCQ        Location/Qualifiers
FT   CDS_pept        68515..69150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spcQ"
FT                   /locus_tag="BSU_00610"
FT                   /old_locus_tag="BSU00610"
FT                   /product="membrane protein of the forespore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10869437, 11283287, 15849754,
FT                   16850406; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11837"
FT                   /db_xref="GOA:P37559"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="SubtiList:BG10124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37559"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10869437, 11283287, 15849754, 16850406"
FT                   /protein_id="CAB11837.1"
FT                   /translation="MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHD
FT                   ILFWIMQGLLFFYVLLHVNEGEFRIYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVS
FT                   VYQFFKKLIQHVLFRPIVWTCGAIIWLAAFLFKKTYSLIGFLLLCLYKIVMVLCFPIRF
FT                   IAKQCLKLLPVKMRLTFRRYFEKGAGFLKKKKKLLITIRTTITRFLKR"
     atgacgctga cgacacaatt ctatacaatg ctagcgatgt ccggtatggg tctctggctt        60
     ggtgcttcgc ttgatacata ccggctcttt gtcattcgtg ccaaaacagc cagatggcta       120
     ttatttattc atgatattct tttctggatt atgcaagggc tgcttttctt ttatgtcttg       180
     cttcatgtaa atgagggaga attcaggatt tacatctttt tagcggttct gctgggcgtt       240
     gcgacgtatc agagcctttg caaacgaatc tatataaaaa tactgaaatt cgtcatttac       300
     cttgttgttt ctgtttatca attcttcaaa aaactcattc agcacgtgtt atttcgtcct       360
     attgtgtgga catgcggagc gatcatctgg ctggcggcat ttttattcaa gaaaacatac       420
     agcctgatag gttttctcct gctgtgtcta tataaaatag tcatggttct gtgttttccg       480
     atccgtttta tcgcgaaaca atgtttgaaa cttcttcctg tgaaaatgcg tctaactttt       540
     agacgttatt ttgaaaaagg tgcaggattt ctcaaaaaga agaagaaact attgataacc       600
     ataagaacga ccatcacacg gtttttgaag agatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page