(data stored in ACNUC7421 zone)

EMBL: AL009126.SPOIIE

AL009126.SPOIIE      Location/Qualifiers
FT   CDS_pept        70538..73021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BSU_00640"
FT                   /old_locus_tag="BSU00640"
FT                   /product="SpoIIAA-phosphate serine phosphatase"
FT                   /function="16.13: Shape"
FT                   /function="16.3: Control"
FT                   /EC_number="3.1.3.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10747015, 12180929, 15126482,
FT                   15866939, 15978076, 28358838; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11840"
FT                   /db_xref="GOA:P37475"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:3T91"
FT                   /db_xref="PDB:3T9Q"
FT                   /db_xref="PDB:5MQH"
FT                   /db_xref="PDB:5UCG"
FT                   /db_xref="SubtiList:BG10127"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10747015, 12180929, 15126482, 15866939, 15978076,
FT                   28358838"
FT                   /protein_id="CAB11840.1"
FT                   /translation="MEKAERRVNGPMAGQALEKLQSFFNRGTKLVTHHLHSLFFYKGFI
FT                   YVVIGFLLGRAFILSEVLPFALPFFGAMLLIRRDKAFYAVLAVLAGALTISPKHSLLIL
FT                   AALLAFFVFSKVAAFITDDRVKALPIVVFFSMAAARAGFVYAQNGVFTTYDYVMAIVEA
FT                   GLSFILTLIFLQSLPIFTVKKVKQSLKIEEIICFMILIASVLTGLAGLSYQGMQAEHIL
FT                   ARYVVLSFSFIGGASIGCTVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAG
FT                   AAIGLIVGSLLISLYGEGSAGLMTTLYESLIAVCLFLLTPQSITRKVARYIPGTVEHLQ
FT                   EQQQYARKIRDVTAQKVDQFSNVFHALSESFATFYQASDEQTDDSEVDLFLSKITEHSC
FT                   QTCYKKNRCWVQNFDKTYDLMKQVMLETEEKEYASNRRLKKEFQQYCSKSKQVEELIED
FT                   ELAHHHAHLTLKKKVQDSRRLVAEQLLGVSEVMADFSREIKREREQHFLQEEQIIEALQ
FT                   HFGIEIQHVEIYSLEQGNIDIEMTIPFSGHGESEKIIAPMLSDILEEQILVKAEQHSPH
FT                   PNGYSHVAFGSTKSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGMGNGAR
FT                   AHFESNETIKLLEKILESGIDEKIAIKTINSILSLRTTDEIYSTLDLSIIDLQDASCKF
FT                   LKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFEGPK
FT                   HVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWA
FT                   SIPVPAIFQNKQEIS"
     atggaaaaag cagaaagaag agtgaacggg ccaatggcgg gacaagcttt ggaaaaactc        60
     caatcgtttt ttaacagggg cacgaagctg gtgactcatc atttgcattc actgtttttc       120
     tataaaggat tcatttatgt tgtcatcgga tttttgcttg gacgggcttt catattatcc       180
     gaggtgcttc ctttcgcact tcctttcttt ggagcgatgc ttcttatcag aagagacaaa       240
     gcgttttatg cggttttggc tgtgcttgca ggtgcgctga ccatatctcc aaagcactca       300
     ttgctcatac tggcggcatt gctggcattc ttcgtatttt ctaaagtggc tgccttcatt       360
     accgacgatc gtgttaaagc gctcccgatt gtcgtgttct tctccatggc tgcagcaaga       420
     gccgggtttg tttatgccca aaatggcgta tttacaacct atgattatgt aatggctatc       480
     gttgaggctg gactatcgtt tatcttaaca ctgattttcc ttcagagcct tccgattttt       540
     actgtgaaaa aagtgaaaca atcattaaaa atagaggaaa tcatttgctt tatgattctt       600
     attgcctctg ttttaacggg gctggctggc ttgtcctacc aagggatgca ggcagaacat       660
     atattggctc gttatgttgt gttgagtttt tcctttattg gcggagcaag catcggctgt       720
     acggttgggg ttgtgaccgg cctgattctt ggcttggcga atatcggaaa cctatatcaa       780
     atgagtctgc ttgctttttc cggtttattg ggcggtttgc tgaaggaagg gaaaaaagcg       840
     ggtgcagcaa ttggtttgat cgttggatca cttcttatat ctttatatgg tgaaggctct       900
     gccggtctga tgacaacgct ctatgagtca ttaatcgcag tctgcctgtt tttgctcaca       960
     cctcaatcta ttacgaggaa agtggcgaga tatattccgg gaactgtcga gcatcttcaa      1020
     gagcaacagc aatacgctag aaaaatccgt gatgtcactg ctcagaaggt agaccaattc      1080
     tccaatgtat ttcacgcgct gtctgaaagc tttgcaacct tttatcaagc atcagacgaa      1140
     cagacagatg acagcgaagt tgatctgttc ttaagcaaaa tcacggagca ttcctgccag      1200
     acgtgctaca agaaaaacag gtgctgggta cagaactttg ataaaacata tgacttaatg      1260
     aaacaagtta tgcttgaaac agaggaaaaa gaatatgcat caaaccgaag gctgaaaaaa      1320
     gagtttcaac agtattgttc taaatccaag caggttgaag agctgattga ggatgagctc      1380
     gcacatcatc atgcccattt gacactcaag aaaaaagtcc aagacagcag gcgccttgtt      1440
     gctgaacagc ttttaggcgt ttctgaggtt atggccgact tttctcggga aataaaaaga      1500
     gagcgagaac aacactttct gcaggaagag caaatcatag aagcgcttca gcatttcgga      1560
     attgagattc agcatgtcga gatctatagt cttgaacaag gaaatatcga tattgaaatg      1620
     accattccgt tcagcggaca tggagaaagt gaaaaaatca ttgctcctat gctttctgac      1680
     attctggagg aacaaattct tgtgaaagcc gaacagcact ctccgcatcc gaatggatac      1740
     agccatgtcg cctttggatc aacaaaatca tacagggtgt ccacgggagc tgctcacgct      1800
     gcgaagggcg gcggccttgt ctccggtgac agctacagca tgatggagct tggagccaga      1860
     aaatatgctg cagcaatcag tgacggaatg ggcaatggcg caagagcgca ctttgaaagc      1920
     aatgaaacga tcaagcttct tgaaaaaatc cttgaatcgg gcattgatga aaaaatagca      1980
     attaaaacga tcaacagcat actgtctcta aggacaactg acgaaatata ttccacgctt      2040
     gacctatcta ttatcgatct tcaagatgcc agctgtaaat ttttgaaggt tggatcgacg      2100
     cccagcttta tcaaacgggg tgaccaggtc atgaaagttc aagcgagcaa tctgccaatc      2160
     ggtattatta atgaattcga tgtggaggtt gtgagtgaac agctgaaagc gggtgacctc      2220
     ttaattatga tgagtgatgg catttttgag gggcctaagc atgtggaaaa tcacgactta      2280
     tggatgaagc gtaaaatgaa agggttgaaa acaaatgacc cgcaggagat tgccgatttg      2340
     cttatggaag aagtcatccg cacaagatcc ggccaaattg aggacgatat gactgttgtt      2400
     gtcgtccgga ttgatcacaa tacaccgaag tgggcatcca ttcctgttcc ggcaatcttt      2460
     caaaacaaac aagaaatttc ataa                                             2484
//

If you have problems or comments...

PBIL Back to PBIL home page