(data stored in ACNUC7421 zone)

EMBL: AL009126.SRFAA

AL009126.SRFAA       Location/Qualifiers
FT   CDS_pept        376968..387731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAA"
FT                   /locus_tag="BSU_03480"
FT                   /old_locus_tag="BSU03480"
FT                   /product="surfactin synthetase"
FT                   /function="16.8: Protect"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 8288534,
FT                   8441623, 14762003, 16707694, 26284661, 26268540, 14762003;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12142"
FT                   /db_xref="GOA:P27206"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10168"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27206"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 8288534, 8441623, 14762003,
FT                   16707694, 26284661, 26268540, 14762003"
FT                   /protein_id="CAB12142.2"
FT                   /translation="MEITFYPLTDAQKRIWYTEKFYPHTSISNLAGIGKLVSADAIDYV
FT                   LVEQAIQEFIRRNDAMRLRLRLDENGEPVQYISEYRPVDIKHTDTTEDPNAIEFISQWS
FT                   REETKKPLPLYDCDLFRFSLFTIKENEVWFYANVHHVISDGISMNILGNAIMHIYLELA
FT                   SGSETKEGISHSFIDHVLSEQEYAQSKRFEKDKAFWNKQFESVPELVSLKRNASAGGSL
FT                   DAERFSKDVPEALHQQILSFCEANKVSVLSVFQSLLAAYLYRVSGQNDVVTGTFMGNRT
FT                   NAKEKQMLGMFVSTVPLRTNIDGGQAFSEFVKDRMKDLMKTLRHQKYPYNLLINDLRET
FT                   KSSLTKLFTVSLEYQVMQWQKEEDLAFLTEPIFSGSGLNDVSIHVKDRWDTGKLTIDFD
FT                   YRTDLFSREEINMICERMITMLENALTHPEHTIDELTLISDAEKEKLLARAGGKSVSYR
FT                   KDMTIPELFQEKAELLSDHPAVVFEDRTLSYRTLHEQSARIANVLKQKGVGPDSPVAVL
FT                   IERSERMITAIMGILKAGGAYVPIDPGFPAERIQYILEDCGADFILTESKVAAPEADAE
FT                   LIDLDQAIEEGAEESLNADVNARNLAYIIYTSGTTGRPKGVMIEHRQVHHLVESLQQTI
FT                   YQSGSQTLRMALLAPFHFDASVKQIFASLLLGQTLYIVPKKTVTNGAALTAYYRKNSIE
FT                   ATDGTPAHLQMLAAAGDFEGLKLKHMLIGGEGLSSVVADKLLKLFKEAGTAPRLTNVYG
FT                   PTETCVDASVHPVIPENAVQSAYVPIGKALGNNRLYILDQKGRLQPEGVAGELYIAGDG
FT                   VGRGYLHLPELTEEKFLQDPFVPGDRMYRTGDVVRWLPDGTIEYLGREDDQVKVRGYRI
FT                   ELGEIEAVIQQAPDVAKAVVLARPDEQGNLEVCAYVVQKPGSEFAPAGLREHAARQLPD
FT                   YMVPAYFTEVTEIPLTPSGKVDRRKLFALEVKAVSGTAYTAPRNETEKAIAAIWQDVLN
FT                   VEKAGIFDNFFETGGHSLKAMTLLTKIHKETGIEIPLQFLFEHPTITALAEEADHRESK
FT                   AFAVIEPAEKQEHYPLSLAQQRTYIVSQFEDAGVGYNMPAAAILEGPLDIQKLERAFQG
FT                   LIRRHESLRTSFVLENSTPRQKIHDSVDFNIEMIERGGRSDEAIMASFVRTFDLAKAPL
FT                   FRIGLLGLEENRHMLLFDMHHLISDGVSIGIMLEELARIYKGEQLPDLRLQYKDYAVWQ
FT                   SRQAAEGYKKDQAYWKEVFAGELPVLQLLSDYPRPPVQSFEGDRVSIKLDAGVKDRLNR
FT                   LAEQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDTEGIIGMFVNTLAIRS
FT                   EVKQNETFTQLISRVRKRVLDAFSHQDYPFEWLVEDLNIPRDVSRHPLFDTMFSLQNAT
FT                   EGIPAVGDLSLSVQETNFKIAKFDLTVQARETDEGIEIDVDYSTKLFKQSTADRLLTHF
FT                   ARLLEDAAADPEKPISEYKLLSEEEAASQIQQFNPGRTPYPKDKTIVQLFEEQAANTPD
FT                   HTALQYEGESLTYRELNERANRLARGILSLGAGEGRTAAVLCERSMDMIVSILAVLKSG
FT                   SAYVPIDPEHPIQRMQHFFRDSGAKVLLTQRKLKALAEEAEFKGVIVLADEEESYHADA
FT                   RNLALPLDSAAMANLTYTSGTTGTPKGNIVTHANILRTVKETNYLSITEQDTILGLSNY
FT                   VFDAFMFDMFGSLLNGAKLVLIPKETVLDMARLSRVIERENISILMITTALFHLLVDLN
FT                   PACLSTLRKIMFGGERASVEHVRKALQTVGKGKLLHMYGPSESTVFATYHPVDELEEHT
FT                   LSVPIGKPVSNTEVYILDRTGHVQPAGIAGELCVSGEGLVKGYYNRPELTEEKFVPHPF
FT                   TSGERMYKTGDLARWLPNGDIEFIGRIDHQVKIRGQRIELGEIEHQLQTHDRVQESVVL
FT                   AVDQGAGDKLLCAYYVGEGDISSQEMREHAAKDLPAYMVPAVFIQMDELPLTGNGKIDR
FT                   RALPIPDANVSRGVSYVAPRNGTEQKVADIWAQVLQAEQVGAYDHFFDIGGHSLAGMKM
FT                   LALVHQELGVELSLKDLFQSPTVEGLAQVIASAEKGTAASISPAEKQDTYPVSSPQKRM
FT                   YVLQQLEDAQTSYNMPAVLRLTGELDVERLNSVMQQLMQRHEALRTTFEIKDGETVQRI
FT                   WEEAECEIAYFEAPEEETERIVSEFIKPFKIDQLPLFRIGLIKHSDTEHVLLFDMHHII
FT                   SDGASVGVLIEELSKLYDGETLEPLRIQYKDYAVWQQQFIQSELYKKQEEHWLKELDGE
FT                   LPVLTLPTDYSRPAVQTFEGDRIAFSLEAGKADALRRLAKETDSTLYMVLLASYSAFLS
FT                   KISGQDDIIVGSPVAGRSQADVSRVIGMFVNTLALRTYPKGEKTFADYLNEVKETALSA
FT                   FDAQDYPLEDLIGNVQVQRDTSRNPLFDAVFSMQNANIKDLTMKGIQLEPHPFERKTAK
FT                   FDLTLTADETDGGLTFVLEYNTALFKQETIERWKQYWMELLDAVTGNPNQPLSSLSLVT
FT                   ETEKQALLEAWKGKALPVPTDKTVHQLFEETAQRHKDRPAVTYNGQSWTYGELNAKANR
FT                   LARILMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDS
FT                   GAKLLLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEENPETAVTAENLAYMIYTS
FT                   GTTGQPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAE
FT                   LHVIEEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAV
FT                   KKPYTLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGE
FT                   LCVAGRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWTGGGIEYIGRIDQQVK
FT                   VRGYRIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPESADIEALKSALKET
FT                   LPDYMIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDV
FT                   LGMSEVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEG
FT                   KQADQGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEH
FT                   HDALRMVYREGQEDVIQYNRGLEAASAQLEVIQIEGQAADYEDRIEREAERLQSSIDLQ
FT                   EGGLLKAGLFQAEDGDHLLLAIHHLVVDGVSWRILLEDFAAVYTQLEQGNEPVLPQKTH
FT                   SFAEYAERLQDFANSKAFLKEKEYWRQLEEQAVAAKLPKDRESGDQRMKHTKTIEFSLT
FT                   AEETEQLTTKVHEAYHTEMNDILLTAFGLAMKEWTGQDRVSVHLEGHGREEIIEDLTIS
FT                   RTVGWFTSMYPMVLDMKHADDLGYQLKQMKEDIRHVPNKGVGYGILRYLTAPEHKEDVA
FT                   FSIQPDVSFNYLGQFDEMSDAGLFTRSELPSGQSLSPETEKPNALDVVGYIENGKLTMS
FT                   LAYHSLEFHEKTVQTFSDSFKAHLLRIIEHCLSQDGTELTPSDLGDDDLTLDELDKLME
FT                   IF"
     atggaaataa ctttttaccc tttaacggat gcacaaaaac gaatttggta cacagaaaaa        60
     ttttatcctc acacgagcat ttcaaatctt gcggggattg gtaagctggt ttcagctgat       120
     gcgattgatt atgtgcttgt tgagcaggcg attcaagagt ttattcgcag aaatgacgcc       180
     atgcgccttc ggttgcggct agatgaaaac ggggagcctg ttcaatatat tagcgagtat       240
     cggcctgttg atataaaaca tactgacact actgaagatc cgaatgcgat agagtttatt       300
     tcacaatgga gccgggagga aacgaagaaa cctttgccgc tatacgattg tgatttgttc       360
     cgtttttcct tgttcaccat aaaggaaaat gaagtgtggt tttacgcaaa tgttcatcac       420
     gtgatttctg atggtatctc catgaatatt ctcgggaatg cgatcatgca catttattta       480
     gaattagcca gcggctcaga gacaaaagaa ggaatctcgc attcatttat cgatcatgtt       540
     ttatctgaac aggaatatgc tcaatcgaag cggtttgaaa aggacaaggc gttttggaac       600
     aaacaatttg aatcggtgcc tgaacttgtt tccttgaaac ggaatgcatc cgcaggggga       660
     agtttagatg ctgagaggtt ctctaaagat gtgcctgaag cgcttcatca gcagattctg       720
     tcgttttgtg aggcgaataa agtcagtgtt ctttcggtat ttcaatcgct gctcgccgcc       780
     tatttgtaca gggtcagcgg ccagaatgat gttgtgacgg gaacatttat gggcaaccgg       840
     acaaatgcga aagagaagca gatgcttggc atgtttgttt ctacggttcc gcttcggaca       900
     aacattgacg gcgggcaggc gttttcagaa tttgtcaaag accggatgaa ggatctgatg       960
     aagacacttc gccaccaaaa gtatccgtat aatctcctaa tcaacgattt gcgtgaaaca      1020
     aagagctctc tgaccaagct gttcacggtt tctcttgaat atcaagtgat gcagtggcag      1080
     aaagaagagg atcttgcctt tttgactgag ccgattttca gcggcagcgg attaaatgat      1140
     gtctcaattc atgtaaagga tcgatgggat actgggaaac tcaccataga ttttgattac      1200
     cgcactgatt tattttcacg tgaagaaatc aacatgattt gtgagcgcat gattaccatg      1260
     ctggagaacg cgttaacgca tccagaacat acaattgatg aattaacact gatttctgat      1320
     gcggagaaag agaagctgct tgcgagggcc ggcggtaaat ctgtgagcta ccgtaaggac      1380
     atgacgatac cagagctgtt ccaagaaaag gctgaactgc tttctgatca tccagcggtt      1440
     gtatttgaag atcgcacatt gtcctatcga acgttacatg agcaatctgc acgcatcgcc      1500
     aatgtgctga aacagaaagg ggttggcccg gacagtcctg tcgcggtttt gattgaacgc      1560
     tctgaacgga tgattacagc tatcatggga attttaaaag ccggcggagc ctatgtgccg      1620
     attgatccgg gttttcctgc tgagcgcatt caatatattt tggaggactg cggggcggat      1680
     ttcatcctga ctgaatcgaa ggttgcggcg cctgaagccg atgctgagct gattgactta      1740
     gatcaggcga ttgaggaagg tgcagaagaa agcctgaatg cagatgtgaa cgctcggaac      1800
     cttgcctaca ttatttacac atcgggaaca accggacgcc cgaaaggcgt tatgatcgag      1860
     catcgccagg ttcatcattt ggttgaatct ctgcagcaga cgatttatca aagcggcagc      1920
     caaaccctgc ggatggcatt gcttgcgccg ttccactttg atgcgtcagt gaagcagatc      1980
     ttcgcgtcgc ttcttttggg ccaaaccctt tatatcgtac cgaagaaaac agtgacgaac      2040
     ggggccgccc ttactgcata ttatcggaag aacagcattg aggcgacgga cggaacaccg      2100
     gctcatttgc aaatgctggc agcagcaggc gattttgaag gcctaaaact gaagcacatg      2160
     ctgatcggag gagaaggcct gtcatctgtt gttgcggaca agctgctgaa gctgtttaaa      2220
     gaagccggca cagcgccgcg tttgactaat gtgtacgggc cgactgaaac gtgcgttgac      2280
     gcgtctgttc atccggttat ccctgagaat gcagttcaat cagcgtatgt gccgatcggg      2340
     aaagcgctgg ggaataaccg cttatatatt ttggatcaaa aaggccggct gcagcctgaa      2400
     ggcgtggcgg gtgagcttta tatcgcggga gacggtgtgg gccgaggcta tttacatttg      2460
     cctgaattaa cggaagagaa gtttttacaa gatccattcg tgccgggcga tcgcatgtac      2520
     cggaccgggg acgtggtgcg ctggcttcca gatggaacaa tcgaatattt aggcagagag      2580
     gatgaccagg tcaaagtccg cggataccgg attgagcttg gggaaattga agccgtgatt      2640
     cagcaggcgc cagacgttgc aaaagccgtt gttttggcac gccctgacga acagggaaat      2700
     cttgaggttt gcgcatatgt tgtgcagaag cctggaagcg aatttgcgcc agccggtttg      2760
     agggagcatg cggccagaca gcttcctgac tatatggtgc cggcttactt tacagaagtg      2820
     acagaaattc cgcttacacc aagcggcaaa gtcgaccgcc gcaagctgtt tgcactagag      2880
     gtgaaggctg tcagcggcac tgcctataca gcgccgcgaa atgagactga aaaagcaatc      2940
     gcagccattt ggcaggacgt gctgaacgtt gagaaggcgg ggatctttga caatttcttt      3000
     gaaactggcg gacattcatt aaaagccatg acccttttaa caaagattca taaggaaaca      3060
     ggcattgaga ttccgcttca atttttgttt gagcatccga cgattacggc tcttgcagag      3120
     gaagctgatc acagagaaag caaagctttt gcggtgattg aacctgctga aaaacaggag      3180
     cattacccgc tttcattggc acagcagcga acatatatcg tcagccagtt cgaggatgcg      3240
     ggagtcggct ataacatgcc agcagcagca attctggaag ggcctttaga tattcaaaag      3300
     ctggagcgcg catttcaggg attaatccga cgccacgagt cattgagaac atcatttgtt      3360
     cttgaaaaca gcacgccgag acagaaaatt cacgatagcg ttgatttcaa catcgaaatg      3420
     attgaaagag gcggccgctc agatgaggca attatggctt cattcgttcg gacatttgat      3480
     ttggcgaaag ctccgctgtt cagaatcggt ttgctggggc ttgaagagaa ccgtcatatg      3540
     ctgctgtttg acatgcacca tttgatttct gacggtgtat ccattggcat tatgctggag      3600
     gagttagcac gcatttataa aggcgaacag cttcctgatc ttcgtctcca gtataaggac      3660
     tacgctgtat ggcaaagcag acaggctgct gaagggtaca agaaggacca ggcttattgg      3720
     aaggaagtct ttgcaggcga gctcccggtg cttcagcttc tgtccgatta cccaagacca      3780
     cctgttcaaa gctttgaagg ggatcgggtg tcaatcaagc tggatgcggg ggtaaaggat      3840
     cgcctcaatc gtttggctga acaaaacggc gccactttat atatggtgat gctttccgct      3900
     tactatacgc ttttgtcaaa gtatacgggg caggatgaca tcattgtcgg gacaccgtca      3960
     gcgggcagaa atcactccga tacagagggc attatcggga tgttcgtcaa tacgcttgcg      4020
     attcgcagtg aggtgaagca gaatgagacg tttacccaat tgatctcgcg tgtccgcaaa      4080
     cgggtgctgg atgccttttc tcatcaggac tatccgtttg agtggcttgt tgaagatttg      4140
     aacatcccgc gtgatgttag caggcatccg ctgtttgaca cgatgttcag ccttcaaaac      4200
     gcgacagagg gcattccggc tgtcggcgat ctttccttgt ctgttcaaga gaccaatttc      4260
     aagattgcca aatttgattt gacggtgcag gcgagagaaa ccgatgaagg cattgagatt      4320
     gatgtggatt acagcacaaa gctgtttaaa caaagcacgg cagacaggct gcttacgcat      4380
     tttgcgcgtt tgcttgaaga tgctgcggct gatccagaga agccgatttc tgagtataag      4440
     cttctttctg aagaggaggc tgcttcgcaa attcagcagt ttaacccggg cagaacacct      4500
     tatccgaaag ataaaacaat tgttcagctg tttgaggagc aagcggcgaa tacgccagac      4560
     cacactgcgc ttcaatatga aggcgaatca ctcacttatc gtgaactgaa tgaacgggcc      4620
     aatcgtttag cccgcggcat tctttctctt ggagctggcg aaggcagaac tgcggctgtc      4680
     ttatgcgagc ggtcaatgga tatgattgtg tcgatcttgg cagtattaaa atcaggttcg      4740
     gcttatgttc cgatcgatcc ggaacatccg attcagcgga tgcagcattt cttccgtgac      4800
     agcggagcaa aggtgcttct cactcagagg aaattaaagg ctttggcgga agaagcggaa      4860
     tttaagggcg ttatcgtgct agccgatgag gaagaaagct atcatgccga tgcgcgaaat      4920
     ctcgcactgc ctcttgattc tgcagcaatg gccaacctga cgtatacttc cggaacgact      4980
     ggaacaccta aggggaatat cgtgacacat gccaatattc tccgcacggt gaaggaaacg      5040
     aattatctca gcattacaga acaggatacg attctcggtc tttccaatta cgtgtttgac      5100
     gcgtttatgt tcgatatgtt cggctctttg ttaaacggag ccaagctggt gctgataccg      5160
     aaggaaaccg ttttggacat ggctcgcctg tcccgcgtca ttgaacggga gaacatcagc      5220
     attctcatga ttacaaccgc tttgttccac ttgcttgtgg acttgaatcc ggcatgcttg      5280
     tcaacgcttc gcaagattat gtttggcggg gaacgggctt cggttgagca tgtcagaaaa      5340
     gctttgcaaa cggttggaaa gggcaagctc cttcatatgt atggaccgtc tgaaagcacg      5400
     gttttcgcga cgtatcatcc ggttgatgaa ttggaggagc acacgctgtc tgttccgatt      5460
     ggaaaaccgg tcagcaatac ggaagtatac attcttgacc gtacgggaca cgtgcagcct      5520
     gccgggattg ccggagagct ttgcgtcagc ggcgaaggac tcgtgaaagg ctattacaac      5580
     cgtccagaac tgactgagga gaaatttgtt ccccatccgt ttacatccgg cgaacgcatg      5640
     tataaaacgg gagaccttgc gagatggctg ccgaatggcg acatcgaatt tatcgggcga      5700
     atcgaccatc aggtgaagat tcgcggacag cgcatcgagc ttggagaaat cgaacatcag      5760
     ctgcaaaccc atgatcgtgt tcaggaaagt gttgtgcttg ccgttgatca aggagcggga      5820
     gataaactgt tgtgtgctta ctatgtcgga gaaggagaca tctcatcaca agagatgaga      5880
     gagcatgctg cgaaggactt gccggcatat atggttcctg cggtgtttat ccaaatggac      5940
     gagctgccgc tgacagggaa cggaaaaatt gaccggagag cgctgccgat tcctgatgcc      6000
     aacgtttcaa gaggtgtttc atatgttgcg ccacgcaatg gaacggaaca aaaagtcgcg      6060
     gacatttggg cacaggtact tcaggcagaa caagtcggcg cttatgacca cttctttgac      6120
     attggcggac attcattagc aggcatgaag atgcttgcct tggttcatca ggaactgggc      6180
     gttgagctgt cactcaagga tctcttccag tcaccgacgg ttgagggctt ggcacaggtg      6240
     attgcctctg ctgaaaaagg gacagccgca agtatcagcc cggcagagaa acaagatacg      6300
     tatcctgttt cttcaccgca aaaacggatg tacgtgcttc agcagcttga ggatgcgcaa      6360
     acgagctata acatgccggc ggttctgcgc ctgacaggtg agcttgatgt tgaaaggctt      6420
     aacagcgtca tgcagcagtt aatgcagcgt catgaagcct tgagaaccac gtttgaaata      6480
     aaagatggag aaacggtgca gcggatctgg gaagaggctg agtgcgagat agcctatttc      6540
     gaagccccgg aagaagagac agagcggatc gtttctgagt ttattaagcc tttcaaaatc      6600
     gaccaacttc cactgttcag aatagggctt atcaagcatt cagacactga gcatgtgctg      6660
     ctgttcgata tgcatcatat tatttctgat ggtgcatctg tcggtgtgct gattgaggag      6720
     ctttcaaagc tgtacgacgg agaaaccctt gagccgctcc gtattcaata taaggattat      6780
     gccgtgtggc agcagcagtt cattcagtct gagctttaca agaagcaaga agagcattgg      6840
     ctgaaggagc tggacggaga gctgccggtg ctgacgcttc cgactgatta cagtcggcct      6900
     gccgttcaaa catttgaggg agaccgcatt gcattttcat tagaagcagg caaagctgat      6960
     gctctgcgca ggcttgcaaa agaaacggat tccacgcttt acatggtgct tctggcttca      7020
     tacagtgcgt ttttatcaaa aattagcggg caagacgata tcatcgtcgg ttcacctgtg      7080
     gccggacgat ctcaagcgga cgtcagccgc gtcatcggaa tgttcgtcaa tacattggcg      7140
     ctgcgcacgt atccgaaggg tgaaaagacg tttgctgact atcttaacga agtgaaagaa      7200
     acggcactca gcgcttttga tgcgcaggat tacccacttg aggatttgat cggaaatgtt      7260
     caggttcagc gtgacacaag cagaaatccg ttattcgatg cagttttttc aatgcaaaat      7320
     gcgaatataa aggatttaac aatgaaaggg attcagcttg agccgcatcc gtttgaacgg      7380
     aaaacagcca agtttgacct cacgctgacg gctgacgaaa ccgacggagg gcttacattc      7440
     gtactcgaat acaatacagc tctgtttaag caggaaacga ttgaacgatg gaagcaatat      7500
     tggatggagc ttttagatgc agttactggg aacccgaacc agccgctttc cagcctgtca      7560
     ctggtcaccg agacagaaaa gcaagcgctt cttgaggcat ggaagggcaa agcgctgcct      7620
     gtgccgacag acaaaacggt tcatcagcta ttcgaagaga ctgcccagcg ccacaaagac      7680
     cgcccggctg tcacatacaa cggccagtct tggacgtacg gcgagctgaa tgcgaaggca      7740
     aaccgtctcg cgcggattct gatggactgc ggcatcagcc cggatgaccg cgtcggcgtt      7800
     ctcacgaagc cgtcgcttga aatgtccgcc gcggtgctcg gcgtcttgaa agccggagcg      7860
     gcgtttgtgc cgattgatcc tgactatccg gatcagcgga ttgagtatat tttacaggac      7920
     agcggcgcga agcttctctt gaaacaggaa ggcatttcag tgccggacag ctatacggga      7980
     gatgtcattc ttctcgacgg aagccgcacg attctaagcc tgccgcttga tgaaaacgac      8040
     gaggaaaatc cagaaaccgc tgtaaccgcg gagaacttgg cgtacatgat ttacacgtct      8100
     ggaacgaccg gacagccgaa gggtgtcatg gtcgagcacc atgcgcttgt gaacctgtgc      8160
     ttctggcacc acgacgcgtt cagcatgaca gcggaggacc gcagtgcgaa gtacgcgggc      8220
     tttgggttcg acgcttccat ttgggagatg ttcccgacct ggacgatcgg tgccgaactt      8280
     cacgtcattg aggaagcgat ccgcctcgat atcgtccgcc tgaacgatta ttttgaaacg      8340
     aacggcgtaa cgatcacgtt cctgccgaca cagcttgcgg aacagttcat ggagcttgag      8400
     aacacatcac ttcgcgtatt gcttactgga ggagacaagc tgaagcgcgc agtgaaaaag      8460
     ccgtacacac tcgtcaataa ctacgggccg acagagaata cggtcgttgc cacaagcgca      8520
     gaaatccatc cggaggaagg ctcgctttcc atcggaaggg ccattgccaa tacgagagta      8580
     tacattctcg gcgagggcaa tcaggtgcag ccggaaggcg tagccggaga gctttgcgtg      8640
     gcggggcgcg gactggcacg cggctatctg aatcgagaag acgaaaccgc gaagcggttt      8700
     gtcgctgatc cgtttgtgcc gggtgagcgc atgtaccgca ccggcgattt ggtgaaatgg      8760
     acgggcggcg gcatcgaata catcggccgg atcgaccagc aggtcaaggt ccgcggctac      8820
     cggatcgagc tctcagaaat tgaagtccag ctcgcccagc tttctgaggt gcaggatgcg      8880
     gcggtgacag ctgtcaaaga taaaggcggc aacacagcga tcgcggcgta tgtcacaccg      8940
     gaatcagctg acatagaagc actgaaatca gcactgaagg aaaccctgcc ggattacatg      9000
     atcccggcgt tctgggtgac gctgaacgag cttccggtta cggcaaacgg caaagtggac      9060
     cgcaaagcct tgcctgagcc ggacatcgaa gcgggaagcg gagaatacaa agcgccgacg      9120
     accgacatgg aagagctgct tgccggcatc tggcaggacg tgcttggaat gtctgaagtc      9180
     ggtgtcaccg acaatttctt ctcgcttggc ggagattcca tcaaaggaat tcaaatggcg      9240
     agccgcttga accagcacgg ctggaagctg gaaatgaaag atctcttcca gcacccgacg      9300
     atcgaagagc tcacccagta cgtagagcgt gccgaaggca aacaggcaga ccaaggcccg      9360
     gtggagggcg aagtcatcct gacgccgatc cagcgctggt tctttgaaaa gaacttcacg      9420
     aacaagcacc actggaacca atctgtgatg cttcacgcca agaagggctt tgatcctgaa      9480
     cgggtggaga aaacattgca ggcgctgatc gagcatcatg acgcgctccg catggtctat      9540
     cgtgagggac aggaagacgt cattcaatac aacagaggtc ttgaagctgc ttcagctcaa      9600
     ttggaggtca tccagattga gggccaagct gcagattacg aagaccgaat agagagagaa      9660
     gcggagcgtt tgcaaagcag catcgacttg caggaaggcg gcttgttaaa agcaggcttg      9720
     ttccaagcgg aagacggaga tcacttgctt cttgccattc accacttagt ggttgacggc      9780
     gtgtcgtggc ggattttact ggaggatttc gccgcggtat atacacagct tgagcaaggc      9840
     aatgaaccgg ttctcccgca gaaaacacat tcatttgcag agtatgcaga gagattgcaa      9900
     gacttcgcga actccaaagc ctttttgaaa gaaaaagagt attggagaca gcttgaagaa      9960
     caagctgttg cggcaaagct tccgaaagac cgcgaatctg gtgatcagcg aatgaaacat     10020
     acaaagacaa ttgaattctc gctgactgct gaagagacag aacagctcac cacaaaggtg     10080
     catgaggcat atcacacaga aatgaatgat attttgctga cggcattcgg attggcaatg     10140
     aaggagtgga cgggtcaaga tcgagtaagt gttcatttag aggggcatgg acgtgaagaa     10200
     atcatagaag acctgaccat ttctcgcaca gtcggctggt ttacaagtat gtacccaatg     10260
     gtgctcgata tgaagcatgc ggatgatctg ggctaccagc tgaagcaaat gaaagaagat     10320
     atcagacatg tgccgaataa gggagtcgga tacggcattc tgcgctatct gacggcaccg     10380
     gaacataaag aagatgtggc gttctcgatt cagccggatg tcagcttcaa ctatttaggt     10440
     cagtttgacg aaatgtcgga tgcaggtttg tttacgagat cagagctgcc atcaggacag     10500
     tcattaagcc ctgaaacaga aaaaccgaat gcgctggatg ttgtcggata tatcgaaaac     10560
     ggaaaactga cgatgtcact ggcctatcat tctcttgaat ttcatgaaaa aacagtacaa     10620
     acattcagtg acagctttaa agcgcatctt ctcagaatca ttgaacattg cctatctcaa     10680
     gatggtacgg aactgacccc gagtgatctt ggtgacgacg atttgacgct ggatgagctg     10740
     gataaattaa tggaaatttt ctaa                                            10764
//

If you have problems or comments...

PBIL Back to PBIL home page