(data stored in ACNUC7421 zone)

EMBL: AL009126.SRFAB

AL009126.SRFAB       Location/Qualifiers
FT   CDS_pept        387744..398495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAB"
FT                   /locus_tag="BSU_03490"
FT                   /old_locus_tag="BSU03490"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 16553878,
FT                   17227471, 14762003, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12143"
FT                   /db_xref="GOA:Q04747"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG10169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04747"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 16553878, 17227471, 14762003,
FT                   26284661"
FT                   /protein_id="CAB12143.2"
FT                   /translation="MSKKSIQKVYALTPMQEGMLYHAMLDPHSSSYFTQLELGIHGAFD
FT                   LEIFEKSVNELIRSYDILRTVFVHQQLQKPRQVVLAERKTKVHYEDISHADENRQKEHI
FT                   ERYKQDVQRQGFNLAKDILFKVAVFRLAADQLYLVWSNHHIMMDGWSMGVLMKSLFQNY
FT                   EALRAGRTPANGQGKPYSDYIKWLGKQDNEEAESYWSERLAGFEQPSVLPGRLPVKKDE
FT                   YVNKEYSFTWDETLVARIQQTANLHQVTGPNLFQAVWGIVLSKYNFTDDVIFGTVVSGR
FT                   PSEINGIETMAGLFINTIPVRVKVERDAAFADIFTAVQQHAVEAERYDYVPLYEIQKRS
FT                   ALDGNLLNHLVAFENYPLDQELENGSMEDRLGFSIKVESAFEQTSFDFNLIVYPGKTWT
FT                   VKIKYNGAAFDSAFIERTAEHLTRMMEAAVDQPAAFVREYGLVGDEEQRQIVEVFNSTK
FT                   AELPEGMAVHQVFEEQAKRTPASTAVVYEGTKLTYRELNAAANRLARKLVEHGLQKGET
FT                   AAIMNDRSVETVVGMLAVLKAGAAYVPLDPALPGDRLRFMAEDSSVRMVLIGNSYTGQA
FT                   HQLQVPVLTLDIGFEESEAADNLNLPSAPSDLAYIMYTSGSTGKPKGVMIEHKSILRLV
FT                   KNAGYVPVTEEDRMAQTGAVSFDAGTFEVFGALLNGAALYPVKKETLLDAKQFAAFLRE
FT                   QSITTMWLTSPLFNQLAAKDAGMFGTLRHLIIGGDALVPHIVSKVKQASPSLSLWNGYG
FT                   PTENTTFSTSFLIDREYGGSIPIGKPIGNSTAYIMDEQQCLQPIGAPGELCVGGIGVAR
FT                   GYVNLPELTEKQFLEDPFRPGERIYRTGDLARWLPDGNIEFLGRIDNQVKVRGFRIELG
FT                   EIETKLNMAEHVTEAAVIIRKNKADENEICAYFTADREVAVSELRKTLSQSLPDYMVPA
FT                   HLIQMDSLPLTPNGKINKKELPAPQSEAVQPEYAAPKTESEKKLAEIWEGILGVKAGVT
FT                   DNFFMIGGHSLKAMMMTAKIQEHFHKEVPIKVLFEKPTIQELALYLEENESKEEQTFEP
FT                   IRQASYQQHYPVSPAQRRMYILNQLGQANTSYNVPAVLLLEGEVDKDRLENAIQQLINR
FT                   HEILRTSFDMIDGEVVQTVHKNISFQLEAAKGREEDAEEIIKAFVQPFELNRAPLVRSK
FT                   LVQLEEKRHLLLIDMHHIITDGSSTGILIGDLAKIYQGADLELPQIHYKDYAVWHKEQT
FT                   NYQKDEEYWLDVFKGELPILDLPADFERPAERSFAGERVMFGLDKQITAQIKSLMAETD
FT                   TTMYMFLLAAFNVLLSKYASQDDIIVGSPTAGRTHPDLQGVPGMFVNTVALRTAPAGDK
FT                   TFAQFLEEVKTASLQAFEHQSYPLEELIEKLPLTRDTSRSPLFSVMFNMQNMEIPSLRL
FT                   GDLKISSYSMLHHVAKFDLSLEAVEREEDIGLSFDYATALFKDETIRRWSRHFVNIIKA
FT                   AAANPNVRLSDVDLLSSAETAALLEERHMTQITEATFAALFEKQAQQTPDHSAVKAGGN
FT                   LLTYRELDEQANQLAHHLRAQGAGNEDIVAIVMDRSAEVMVSILGVMKAGAAFLPIDPD
FT                   TPEERIRYSLEDSGAKFAVVNERNMTAIGQYEGIIVSLDDGKWRNESKERPSSISGSRN
FT                   LAYVIYTSGTTGKPKGVQIEHRNLTNYVSWFSEEAGLTENDKTVLLSSYAFDLGYTSMF
FT                   PVLLGGGELHIVQKETYTAPDEIAHYIKEHGITYIKLTPSLFHTIVNTASFAKDANFES
FT                   LRLIVLGGEKIIPTDVIAFRKMYGHTEFINHYGPTEATIGAIAGRVDLYEPDAFAKRPT
FT                   IGRPIANAGALVLNEALKLVPPGASGQLYITGQGLARGYLNRPQLTAERFVENPYSPGS
FT                   LMYKTGDVVRRLSDGTLAFIGRADDQVKIRGYRIEPKEIETVMLSLSGIQEAVVLAVSE
FT                   GGLQELCAYYTSDQDIEKAELRYQLSLTLPSHMIPAFFVQVDAIPLTANGKTDRNALPK
FT                   PNAAQSGGKALAAPETALEESLCRIWQKTLGIEAIGIDDNFFDLGGHSLKGMMLIANIQ
FT                   AELEKSVPLKALFEQPTVRQLAAYMEASAVSGGHQVLKPADKQDMYPLSSAQKRMYVLN
FT                   QLDRQTISYNMPSVLLMEGELDISRLRDSLNQLVNRHESLRTSFMEANGEPVQRIIEKA
FT                   EVDLHVFEAKEDEADQKIKEFIRPFDLNDAPLIRAALLRIEAKKHLLLLDMHHIIADGV
FT                   SRGIFVKELALLYKGEQLPEPTLHYKDFAVWQNEAEQKERMKEHEAYWMSVLSGELPEL
FT                   DLPLDYARPPVQSFKGDTIRFRTGSETAKAVEKLLAETGTTLHMVLHAVFHVFLSKISG
FT                   QRDIVIGSVTAGRTNADVQDMPGMFVNTLALRMEAKEQQTFAELLELAKQTNLSALEHQ
FT                   EYPFEDLVNQLDLPRDMSRNPLFNVMVTTENPDKEQLTLQNLSISPYEAHQGTSKFDLT
FT                   LGGFTDENGIGLQLEYATDLFAKETAEKWSEYVLRLLKAVADNPNQPLSSLLLVTETEK
FT                   QALLEAWKGKALPVPTDKTVHQLFEETVQRHKDRPAVTYNGQSWTYGELNAKANRLARI
FT                   LMDCGISPDDRVGVLTKPSLEMSAAVLGVLKAGAAFVPIDPDYPDQRIEYILQDSGAKL
FT                   LLKQEGISVPDSYTGDVILLDGSRTILSLPLDENDEGNPETAVTAENLAYMIYTSGTTG
FT                   QPKGVMVEHHALVNLCFWHHDAFSMTAEDRSAKYAGFGFDASIWEMFPTWTIGAELHVI
FT                   DEAIRLDIVRLNDYFETNGVTITFLPTQLAEQFMELENTSLRVLLTGGDKLKRAVKKPY
FT                   TLVNNYGPTENTVVATSAEIHPEEGSLSIGRAIANTRVYILGEGNQVQPEGVAGELCVA
FT                   GRGLARGYLNREDETAKRFVADPFVPGERMYRTGDLVKWVNGGIEYIGRIDQQVKVRGY
FT                   RIELSEIEVQLAQLSEVQDAAVTAVKDKGGNTAIAAYVTPETADIEALKSTLKETLPDY
FT                   MIPAFWVTLNELPVTANGKVDRKALPEPDIEAGSGEYKAPTTDMEELLAGIWQDVLGMS
FT                   EVGVTDNFFSLGGDSIKGIQMASRLNQHGWKLEMKDLFQHPTIEELTQYVERAEGKQAD
FT                   QGPVEGEVILTPIQRWFFEKNFTNKHHWNQSVMLHAKKGFDPERVEKTLQALIEHHDAL
FT                   RMVYREENGDIVQVYKPIGESKVSFEIVDLYGSDEEMLRSQIKLLANKLQSSLDLRNGP
FT                   LLKAEQYRTEAGDHLLIAVHHLVVDGVSWRILLEDFASGYMQAEKEESLVFPQKTNSFK
FT                   DWAEELAAFSQSAHLLQQAEYWSQIAAEQVSPLPKDCETEQRIVKDTSSVLCELTAEDT
FT                   KHLLTDVHQPYGTEINDILLSALGLTMKEWTKGAKIGINLEGHGREDIIPNVNISRTVG
FT                   WFTAQYPVVLDISDADASAVIKTVKENLRRIPDKGVGYGILRYFTETAETKGFTPEISF
FT                   NYLGQFDSEVKTDFFEPSAFDMGRQVSGESEALYALSFSGMIRNGRFVLSCSYNEKEFE
FT                   RATVEEQMERFKENLLMLIRHCTEKEDKEFTPSDFSAEDLEMDEMGDIFDMLEENLK"
     atgagcaaaa aatcgattca aaaggtgtac gcactgacac caatgcagga gggaatgctg        60
     tatcatgcga tgcttgatcc gcattcttcc tcgtacttca cacaattaga gcttgggatt       120
     cacggcgctt ttgatcttga aatctttgag aaaagcgtca atgaactgat tcggtcatac       180
     gatattctcc gtacggtatt tgtgcatcag cagctgcaaa aaccgcgtca ggtcgtgtta       240
     gcggaacgca aaacaaaagt gcattatgag gatatcagtc atgcagacga aaaccgccag       300
     aaagagcaca ttgagcgtta caaacaagac gttcagcgcc aaggctttaa cctggcaaaa       360
     gacatattgt tcaaggtagc ggttttccgc cttgctgcag atcagctgta tcttgtctgg       420
     agcaatcatc atattatgat ggacggctgg agcatgggcg tcctcatgaa aagcctgttc       480
     caaaactatg aagcgctcag agcaggcagg acaccggcaa acggtcaggg caagccttat       540
     tccgattaca tcaagtggct tggaaaacag gacaatgaag aagcggagag ctactggagc       600
     gagcgcttgg cgggttttga acagccaagc gtgctcccgg gccgcctgcc tgtgaaaaaa       660
     gacgaatacg tcaataaaga atattcattt acatgggacg aaacactggt tgcccgtatt       720
     cagcaaaccg caaatctcca tcaagtgaca gggcctaacc tatttcaggc cgtttggggc       780
     attgttctca gcaaatacaa ctttacggat gatgtgatct tcggaacggt cgtctcggga       840
     cgaccgtctg aaatcaacgg aatcgaaacg atggcggggc tgtttatcaa caccattcca       900
     gtgcgggtga aagttgaacg agatgctgca ttcgctgata ttttcacagc tgttcagcag       960
     catgcagtag aggcagagcg ttacgattac gtgccgctct atgagattca aaaacgctca      1020
     gctcttgatg gcaatctctt aaaccatctg gtcgcgtttg aaaattatcc gcttgatcaa      1080
     gagcttgaaa acggcagcat ggaagaccgc ctcgggtttt cgattaaggt agaaagcgca      1140
     tttgaacaaa cgagcttcga tttcaacctg attgtgtatc cgggcaaaac gtggaccgtc      1200
     aaaattaaat ataacggagc cgcctttgat tccgctttta tcgaacggac agcggagcac      1260
     cttacccgca tgatggaagc agctgtcgat cagccggccg cttttgtgcg tgagtacggg      1320
     cttgtgggag acgaagagca gcggcaaatt gtcgaggtgt ttaacagcac gaaagccgaa      1380
     ctccctgaag gaatggctgt tcaccaagtg tttgaagagc aagcgaaacg gacgccggcg      1440
     agcaccgccg tcgtatatga aggaaccaag ctgacgtacc gcgagctgaa tgcagcggct      1500
     aaccgtctgg cgagaaagct tgtcgaacat gggcttcaaa aaggggaaac agcagcgatt      1560
     atgaacgacc gctcagtaga aaccgttgtc ggcatgctgg ctgttttaaa agcaggcgcc      1620
     gcatatgtgc cgcttgatcc agcgcttcct ggggatcgtc ttcgtttcat ggcagaggac      1680
     agctccgttc gaatggtttt gatcggaaat tcttatacag ggcaggcaca tcagctgcaa      1740
     gtgccggttc ttacactgga cataggcttt gaagagagtg aagcggctga caatctcaac      1800
     ctgccatccg ccccgtctga tttggcgtac atcatgtaca catccggttc aacgggcaaa      1860
     ccgaaaggcg tcatgatcga acataaaagc attctgcgcc tcgtcaaaaa tgccgggtac      1920
     gttcctgtta ctgaagaaga ccgcatggcg caaacgggag ctgtcagctt tgatgccgga      1980
     acgtttgagg tattcggcgc actgctgaat ggcgcagcac tttatccggt caaaaaagag      2040
     acactgcttg atgcgaaaca atttgctgca ttcctgcgtg agcaaagcat cacaactatg      2100
     tggctgacat cacctttatt caaccagctt gctgcaaagg atgcgggtat gttcggcaca      2160
     ctgcgccatt taatcatcgg cggagatgcc cttgtcccgc atattgtcag caaagtaaaa      2220
     caggcatcgc cgtcgctttc attgtggaac ggatacggcc cgacagaaaa cacgacgttt      2280
     tcaaccagtt ttctgatcga ccgcgagtat ggcggctcta tcccaatcgg gaagccgatc      2340
     ggaaattcca ctgcctatat tatggatgag cagcaatgcc tgcagccaat cggcgcgcct      2400
     ggtgagcttt gcgtaggcgg aatcggtgta gcgcgtgggt atgtcaatct ccctgagctg      2460
     acggagaagc aatttctgga agacccgttc agaccgggtg agagaattta ccgcactggt      2520
     gacttggcaa gatggctgcc ggacggcaat atcgaatttt taggcagaat cgacaaccaa      2580
     gtgaaggtgc gcggcttccg aattgagctt ggcgaaattg aaacaaaact gaacatggct      2640
     gagcatgtga cagaagccgc ggtgatcata cgcaagaaca aagcagacga aaatgaaatt      2700
     tgcgcgtact tcacggcgga tcgtgaagtg gctgtgagtg agctgagaaa aacactgtct      2760
     cagtctttgc ctgactatat ggtccctgcc cacctgattc aaatggacag cctgccgctc      2820
     acgccaaacg ggaaaatcaa caaaaaggaa ctgcctgcac cgcaatcaga agccgtgcag      2880
     ccggaatacg cagcaccaaa aacagagagt gaaaagaaat tagcggagat ctgggaagga      2940
     atactcggcg tcaaagcagg cgttaccgat aacttcttta tgatcggcgg ccattctttg      3000
     aaagcgatga tgatgacggc gaaaattcaa gagcattttc ataaggaagt tccgataaaa      3060
     gtgctttttg aaaagccgac tattcaagaa ctggcactgt atttggaaga gaacgaaagc      3120
     aaggaggagc agacgtttga accgatcagg caagcatctt atcagcagca ttatcctgta      3180
     tccccggccc agcggagaat gtatatcctc aatcagcttg gacaagcaaa cacaagctac      3240
     aacgtccccg ctgtacttct gctggaggga gaagtagata aagaccggct tgaaaacgcg      3300
     attcagcaat taatcaaccg gcacgaaatc ctccgtacat cgtttgacat gatcgacgga      3360
     gaggttgtgc aaaccgttca taaaaacata tcgttccagc tggaggctgc caagggacgg      3420
     gaagaagacg cggaagagat aatcaaagca tttgttcagc cgtttgaatt aaaccgcgcg      3480
     ccgctcgtcc gttcgaagct tgtccagctg gaagaaaaac gccacctgct gctcattgat      3540
     atgcatcata ttattactga cggaagttca acaggcattc taatcggtga tcttgccaaa      3600
     atatatcaag gcgcagatct ggaactgcca caaattcact ataaagatta cgcagtttgg      3660
     cacaaagaac aaactaatta tcaaaaagat gaggaatact ggctcgatgt ctttaaaggc      3720
     gaactgccaa tactggatct tcccgcggat ttcgagcggc cagctgaacg gagctttgcg      3780
     ggagagcgcg tgatgtttgg gcttgataag caaatcacgg ctcaaatcaa atcgctcatg      3840
     gcagaaacag atacgacaat gtacatgttt ttgctggcgg cgttcaatgt actcctttcc      3900
     aagtacgcgt cacaggatga tatcattgtc ggctcgccga cagctggcag aacacatcct      3960
     gatctgcaag gtgtgccggg tatgtttgtc aacacggtgg cactcagaac ggcaccagcg      4020
     ggagataaaa ccttcgcgca attccttgaa gaggtcaaaa cagccagcct tcaagcattc      4080
     gagcaccaga gctatccgct tgaggagctg attgaaaagc ttccgcttac aagggataca      4140
     agcagaagtc cgctgttcag cgtgatgttc aacatgcaga atatggagat tccttcatta      4200
     agattaggag atttgaagat ttcctcgtat tccatgcttc atcatgttgc gaaatttgat      4260
     ctttccttgg aagcggtcga gcgtgaagag gatatcggcc taagctttga ctatgcgact      4320
     gccttgttta aggacgagac gatccgccgc tggagccgcc actttgtcaa tatcatcaaa      4380
     gcggccgcgg ctaatccgaa cgttcggctg tctgatgtag atctgctttc atctgcagaa      4440
     acggctgctt tgctagaaga aagacatatg actcaaatta ccgaagcaac ctttgcagca      4500
     ctttttgaaa aacaggccca gcaaacacct gaccattctg cggtgaaggc tggcggaaat      4560
     ctgttgacct atcgcgagct tgatgaacag gcgaaccagc tggcgcatca tcttcgtgcc      4620
     caaggggcag gaaatgaaga catcgtcgcg attgttatgg accggtcagc tgaagtcatg      4680
     gtatccattc tcggtgtcat gaaggcgggg gcagctttcc ttccgattga tcctgataca      4740
     cctgaagaac gaatccgtta ttcattagag gacagcggag caaaatttgc ggtcgtgaat      4800
     gaaagaaaca tgacggctat tgggcaatat gaagggataa ttgtcagcct tgatgacggt      4860
     aaatggagaa atgaaagcaa ggagcgccca tcatccattt ccgggtctcg caatcttgca      4920
     tacgtcattt atacgtccgg tacgaccgga aagccaaagg gcgtgcagat tgagcatcgt      4980
     aatctgacaa actatgtctc ttggtttagt gaagaggcgg gcctgacgga aaatgataag      5040
     actgtattgc tttcatctta cgcatttgac cttggctata cgagcatgtt ccctgtactt      5100
     ctgggcgggg gcgagctcca tatcgtccag aaggaaacct atacggcgcc ggatgaaata      5160
     gcgcactata tcaaggagca tgggatcact tatatcaagc tgacaccgtc tctgttccat      5220
     acaatagtga acaccgccag ttttgcaaaa gatgcgaact ttgaatcctt gcgcttgatc      5280
     gtcttgggag gagaaaaaat catcccgact gatgttatcg ccttccgtaa gatgtatgga      5340
     cataccgaat ttatcaatca ctacggcccg acagaagcaa cgatcggcgc catcgccggg      5400
     cgggttgatc tgtatgagcc ggatgcattt gcgaaacgcc cgacaatcgg acgcccgatt      5460
     gcgaatgccg gtgcgcttgt cttaaatgaa gcattgaagc ttgtgccgcc tggagcgagc      5520
     ggacagctct atatcacggg acaggggctc gcgagagggt atctcaacag gcctcagctg      5580
     acagccgaga gatttgtaga aaatccatat tcgccgggaa gcctcatgta caaaaccgga      5640
     gatgtcgtac gaagactttc tgacggtacg cttgcattta tcggccgggc tgatgatcag      5700
     gtgaaaatcc gaggctaccg cattgagccg aaagaaattg aaacggtcat gctcagcctc      5760
     agcggaattc aagaagcggt tgtactagcg gtttccgagg gcggtcttca agagctttgc      5820
     gcgtattata cgtcggatca agatattgaa aaagcagagc tccggtacca gctttcccta      5880
     acactgccgt ctcatatgat tcctgctttc tttgtgcagg ttgacgcgat tccgctgacg      5940
     gcaaacggaa aaaccgacag aaacgctctg ccgaagccta acgcggcaca atccggaggc      6000
     aaggccttgg ccgcaccgga gacagcgctt gaagaaagtt tatgccgcat ttggcagaaa      6060
     acgcttggca tagaagccat cggcattgat gacaattttt tcgatttagg cggccattca      6120
     ttaaaaggga tgatgctgat tgccaacatt caggcggaat tggagaaaag cgtaccgctt      6180
     aaagcactgt tcgagcagcc gacagttcgc cagctggcgg cttatatgga ggcgtctgct      6240
     gtttcaggcg gccatcaagt actcaaaccg gctgacaagc aggatatgta tccattgtca      6300
     tccgcacaga aacgaatgta cgtgctcaat cagcttgacc gccagacgat aagctacaac      6360
     atgccatctg ttcttctaat ggaaggagag cttgatattt cgcgcctgcg cgactcactc      6420
     aatcagcttg tgaaccgtca cgaatcattg cggacgtcat ttatggaagc taatggtgag      6480
     cctgttcagc gcatcattga gaaggcggag gttgatcttc atgtgtttga agccaaagaa      6540
     gacgaagcgg accaaaagat taaggaattt atccggccat tcgacttaaa cgacgcaccg      6600
     ctcattcgcg cagctttgct tcgaatagaa gcgaaaaaac atttgctgct tttagatatg      6660
     catcatatca tcgcagacgg cgtctcaaga ggcatctttg taaaagaatt ggcgctgctt      6720
     tacaaaggag agcagcttcc ggagccgacg cttcattata aagatttcgc cgtttggcaa      6780
     aatgaagctg agcaaaaaga acggatgaag gagcatgagg cgtactggat gtcagttctt      6840
     tcaggcgagc tgccagagct tgatctcccg ctcgattatg cccgtccgcc tgtgcaaagc      6900
     tttaaaggag atacgatccg tttccgtacg ggaagtgaga cggcaaaggc ggtagaaaaa      6960
     ctgcttgccg aaaccggaac gaccttgcac atggtgctcc atgctgtttt ccacgtcttt      7020
     ttaagcaaaa tttccggaca gcgggatatc gtcatcggct ccgttactgc cggccggacg      7080
     aatgctgatg ttcaggacat gccgggaatg ttcgtcaata cacttgccct gagaatggaa      7140
     gcgaaagaac agcaaacatt tgcggagctt ttggagctag caaagcagac gaacctgtca      7200
     gcccttgagc atcaggagta tccgtttgaa gatctggtta atcagcttga tctccctcgg      7260
     gatatgagcc gaaacccatt gtttaatgtg atggtgacga cagaaaaccc tgataaagaa      7320
     cagcttacat tgcaaaatct gagcatttca ccttatgagg ctcatcaggg aacttctaag      7380
     tttgatctga cactgggcgg atttactgat gaaaatggca ttggcttgca gctcgaatat      7440
     gcgacagatc tgttcgcaaa agaaacagct gaaaaatgga gcgaatacgt tctgcggcta      7500
     ctaaaggctg ttgcggataa cccgaaccag ccgctttcca gtctgttact ggtcaccgag      7560
     acagaaaagc aagcgcttct tgaggcatgg aagggcaaag cgctgcctgt gccgacagac      7620
     aaaacggttc atcagctatt cgaagagact gtccagcgcc acaaagaccg cccggctgtc      7680
     acatacaacg gccaatcttg gacgtacggc gagctgaacg cgaaggcaaa ccgcctcgcc      7740
     cggattctga tggactgcgg catcagcccg gatgaccgcg tcggcgttct cacgaagccg      7800
     tcgcttgaaa tgtccgccgc ggtgctcggc gtcttgaaag ccggagcggc gtttgtgccg      7860
     attgatcctg actacccgga tcagcggatt gagtatattt tacaggacag cggcgcgaag      7920
     cttctcttga aacaggaagg catttcagtg ccggacagct atacgggaga tgtcattctt      7980
     ctcgacggaa gccgcacgat tctaagcctg ccgcttgatg aaaacgacga gggaaatcca      8040
     gaaaccgctg taaccgcgga gaacttggcg tacatgattt acacgtctgg aacgaccgga      8100
     cagccgaagg gtgtcatggt cgagcaccat gcgcttgtga acctgtgctt ctggcaccac      8160
     gacgcgttca gcatgacagc ggaggaccgc agtgcgaagt acgcgggctt cgggttcgac      8220
     gcttccattt gggagatgtt cccgacctgg acgatcggcg ctgaacttca cgtcattgat      8280
     gaagcgatcc gcctcgatat cgtccgcctg aacgattatt ttgaaacgaa cggcgtaacg      8340
     atcacgttcc tgccgacaca gcttgcggaa cagttcatgg agcttgagaa cacatcactt      8400
     cgcgtcctct tgaccggagg agacaagctg aagcgggcag tgaaaaagcc gtacacactc      8460
     gtcaacaact acgggccgac agaaaatacg gtcgttgcca caagcgcaga aatccatccg      8520
     gaggaaggct cgctttccat cggacgggcc attgccaata cgagagtata cattctcggc      8580
     gagggcaatc aggtgcagcc ggaaggcgta gccggagagc tttgcgtggc ggggcgcgga      8640
     ctggcacgag gctatctgaa tcgagaagac gaaaccgcga agcggtttgt cgctgatccg      8700
     tttgtgccgg gtgaacgcat gtaccgcacc ggcgacttgg tgaagtgggt gaacggcggc      8760
     atcgaataca tcggccggat cgaccagcag gtcaaggtcc gcggctaccg gatcgagctc      8820
     tcagaaattg aagtccagct cgcccagctt tctgaggtgc aggatgcggc ggtgacagct      8880
     gtcaaagata aaggcggcaa tacagcgatc gcggcgtatg tcacaccgga aacagctgac      8940
     atagaagcac taaaatcaac actaaaggaa accctgccgg attacatgat cccggcgttc      9000
     tgggtgacgc tgaacgagct tccggttacg gcaaacggca aagtcgaccg caaagccttg      9060
     cctgagccgg acatcgaagc gggaagcgga gaatacaaag cgccgacgac cgacatggaa      9120
     gagctgcttg ccggcatctg gcaggacgtg cttggaatgt ctgaagtcgg tgtcaccgac      9180
     aatttcttct cgcttggcgg agattccatc aaaggaattc aaatggcgag ccgcttgaat      9240
     cagcacggct ggaagctgga aatgaaagat ctcttccagc atccgacgat cgaagagctc      9300
     acccagtacg tagagcgtgc cgaaggcaaa caggcagacc aaggcccggt ggagggcgaa      9360
     gtcatcctga cgccgatcca gcgctggttc tttgaaaaga acttcacgaa caagcaccac      9420
     tggaaccaat cggtgatgct tcacgccaaa aagggctttg atcctgaacg ggtggagaaa      9480
     acattgcagg cgctgatcga gcatcatgac gcgctccgca tggtctaccg cgaggaaaac      9540
     ggggacatcg ttcaggtgta taaaccgatc ggtgagagca aggtcagctt cgaaatcgtg      9600
     gatctgtacg gctccgatga agagatgctg agaagccaga ttaagcttct cgcgaacaag      9660
     ctgcaaagca gtctcgatct gcgaaacggg ccgcttttaa aggcggagca atatcgcaca      9720
     gaagctgggg atcacctgct cattgctgta caccatctcg tggtcgacgg tgtgtcatgg      9780
     cggattttgc ttgaagactt tgcttcaggc tacatgcagg ctgagaaaga agagagcctt      9840
     gtcttcccgc aaaaaacaaa ctccttcaag gattgggcgg aagaactggc ggcattcagc      9900
     caatcagcgc atcttttaca gcaggctgaa tactggtcgc aaattgccgc tgaacaggtt      9960
     tctcctttac ctaaggattg tgaaacagag cagcggatcg tcaaggatac atcatctgtc     10020
     ctatgtgaat taacggcaga agacactaag catcttttaa cagatgttca tcagccatat     10080
     ggaactgaaa tcaacgatat tcttctcagc gcgctcggtt tgacaatgaa agaatggaca     10140
     aagggggcca aaattggcat taaccttgag ggacacggcc gggaggacat tatcccgaat     10200
     gtgaatatct ccagaacggt cggctggttt acggcacaat accctgttgt gctcgacata     10260
     tctgacgcag atgcctcagc tgtgatcaaa acagtcaaag aaaacctgcg ccgcattccg     10320
     gacaaaggtg ttggctacgg cattcttcgt tatttcacag aaacagcgga aacaaagggc     10380
     ttcacaccgg agatcagctt caactatttg ggccaattcg acagtgaagt caaaaccgat     10440
     ttctttgaac cgtccgcttt cgatatgggg cgccaagtaa gcggagaatc agaggcgctg     10500
     tacgcattaa gcttcagcgg catgatcaga aacggccggt ttgtgctttc ctgctcctac     10560
     aatgagaagg agtttgaaag agctacagtc gaggagcaaa tggaacggtt taaagaaaac     10620
     ctcctgatgc taatccgcca ttgcacggaa aaagaagaca aggaattcac accaagcgac     10680
     ttcagcgccg aagaccttga aatggacgag atgggagata tctttgacat gcttgaggag     10740
     aatttaaaat aa                                                         10752
//

If you have problems or comments...

PBIL Back to PBIL home page